OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SRA1 (NM_001035235) Human Mass Spec Standard

Be the first to review this product
SKU
PH320899
SRA1 MS Standard C13 and N15-labeled recombinant protein (NP_001030312)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA357930 SRA1 Antibody - middle region
100 ul
$585.00
LY422126 Transient overexpression lysate of steroid receptor RNA activator 1 (SRA1) (as WB positive control) 100 ug
$436.00

Other products for "SRA1 or NM_001035235"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC220899
Predicted MW 25.5 kDa
Protein Sequence
Protein Sequence
>RC220899 representing NM_001035235
Red=Cloning site Green=Tags(s)

MTRCPAGQAEVEMAELYVKPGNKERGWNDPPQFSYGLQTQAGGPRRSLLTKRVAAPQDGSPRVPASETSP
GPPPMGPPPPSSKAPRSPPVGSGPASGVEPTSFPVESEAVMEDVLRPLEQALEDCRGHTRKQVCDDISRR
LALLQEQWAGGKLSIPVKKRMALLVQELSSHRWDAADDIHRSLMVDHVTEVSQWMVGVKRLIAEKRSLFS
EEAANEEKSAATAEKNHTIPGFQQAS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001030312
RefSeq Size 1534
RefSeq ORF 708
Synonyms pp7684; SRA; SRAP; STRAA1
Locus ID 10011
UniProt ID Q9HD15
Cytogenetics 5q31.3
Summary Both long non-coding and protein-coding RNAs are transcribed from this gene, and they represent alternatively spliced transcript variants. This gene was initially defined as a non-coding RNA, which is a coactivator for several nuclear receptors (NRs) and is associated with breast cancer. It has now been found that this gene is involved in the regulation of many NR and non-NR activities, including metabolism, adipogenesis and chromatin organization. The long non-coding RNA transcripts interact with a variety of proteins, including the protein encoded by this gene. The encoded protein acts as a transcriptional repressor by binding to the non-coding RNA. provided by RefSeq, Mar 2012
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SRA1" proteins (3)
SKU Description Size Price
LC422126 Lyophilized SRA1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY422126 Transient overexpression lysate of steroid receptor RNA activator 1 (SRA1) (as WB positive control) 100 ug
$436.00
TP320899 Recombinant protein of human steroid receptor RNA activator 1 (SRA1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products