PGEA1 (CBY1) (NM_015373) Human Mass Spec Standard

SKU PH320783

CBY1 MS Standard C13 and N15-labeled recombinant protein (NP_056188)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC220783]
• Predicted MW: 14.3 kDa
• Protein Sequence:
  Protein Sequence

  >RC220783 representing NM_015373; Red=Cloning site Green=Tags(s); ; MPFFGNTFSPKKTPPRKSASLSNLHSLDRSTREVELGLEYGSPTMNLAGQSLKFENGQWIAETGVSGGVD; RREVQRLRRRNQQLEEENNLLRLKVDILLDMLSESTAESHLMEKELDELRISRKRK; ; SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_056188
• RefSeq Size: 1147
• RefSeq ORF: 378
• Synonyms: arb1; C22orf2; CBY; Chibby1; HS508I15A; PGEA1; PIGEA-14; PIGEA14
• Locus ID: 25776
• UniProt ID: Q9Y3M2
• Cytogenetics: 22q13.1
• Summary: Beta-catenin is a transcriptional activator and oncoprotein involved in the development of several cancers. The protein encoded by this gene interacts directly with the C-terminal region of beta-catenin, inhibiting oncogenic beta-catenin-mediated transcriptional activation by competing with transcription factors for binding to beta-catenin. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
• Protein Families: Transcription Factors