WDR42A (DCAF8) (NM_015726) Human Mass Spec Standard

SKU
PH320579
DCAF8 MS Standard C13 and N15-labeled recombinant protein (NP_056541)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC220579]
Predicted MW 66.9 kDa
Protein Sequence
Protein Sequence
>RC220579 protein sequence
Red=Cloning site Green=Tags(s)

MSSKGSSTDGRTDLANGSLSSSPEEMSGAEEGRETSSGIEVEASDLSLSLTGDDGGPNRTSTESRGTDTE
SSGEDKDSDSMEDTGHYSINDENRVHDRSEEEEEEEEEEEEEQPRRRVQRKRANRDQDSSDDERALEDWV
SSETSALPRPRWQALPALRERELGSSARFVYEACGARVFVQRFRLQHGLEGHTGCVNTLHFNQRGTWLAS
GSDDLKVVVWDWVRRQPVLDFESGHKSNVFQAKFLPNSGDSTLAMCARDGQVRVAELSATQCCKNTKRVA
QHKGASHKLALEPDSPCTFLSAGEDAVVFTIDLRQDRPASKLVVTKEKEKKVGLYTIYVNPANTHQFAVG
GRDQFVRIYDQRKIDENENNGVLKKFCPHHLVNSESKANITCLVYSHDGTELLASYNDEDIYLFNSSHSD
GAQYVKRYKGHRNNATVKGVNFYGPKSEFVVSGSDCGHIFLWEKSSCQIIQFMEGDKGGVVNCLEPHPHL
PVLATSGLDHDVKIWAPTAEASTELTGLKDVIKKNKRERDEDSLHQTDLFDSHMLWFLMHHLRQRRHHRR
WREPGVGATDADSDESPSSSDTSDEEEGPDRVQCMPS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_056541
RefSeq Size 3901
RefSeq ORF 1791
Synonyms GAN2; H326; WDR42A
Locus ID 50717
UniProt ID Q5TAQ9
Cytogenetics 1q23.2
Summary This gene encodes a WD repeat-containing protein that interacts with the Cul4-Ddb1 E3 ligase macromolecular complex. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2009]
Write Your Own Review
You're reviewing:WDR42A (DCAF8) (NM_015726) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC414360 DCAF8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY414360 Transient overexpression lysate of DDB1 and CUL4 associated factor 8 (DCAF8), transcript variant 1 100 ug
$665.00
TP320579 Recombinant protein of human WD repeat domain 42A (WDR42A), 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.