FHL2 (NM_201555) Human Mass Spec Standard

SKU
PH320395
FHL2 MS Standard C13 and N15-labeled recombinant protein (NP_963849)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC220395]
Predicted MW 32.2 kDa
Protein Sequence
Protein Sequence
>RC220395 protein sequence
Red=Cloning site Green=Tags(s)

MTERFDCHHCNESLFGKKYILREESPYCVVCFETLFANTCEECGKPIGCDCKDLSYKDRHWHEACFHCSQ
CRNSLVDKPFAAKEDQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGSSWHETCFICHRCQQPIGTKS
FIPKDNQNFCVPCYEKQHAMQCVQCKKPITTGGVTYREQPWHKECFVCTACRKQLSGQRFTARDDFAYCL
NCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDCGKDI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_963849
RefSeq Size 1907
RefSeq ORF 837
Synonyms AAG11; DRAL; FHL-2; SLIM-3; SLIM3
Locus ID 2274
UniProt ID Q14192
Cytogenetics 2q12.2
Summary This gene encodes a member of the four-and-a-half-LIM-only protein family. Family members contain two highly conserved, tandemly arranged, zinc finger domains with four highly conserved cysteines binding a zinc atom in each zinc finger. This protein is thought to have a role in the assembly of extracellular membranes. Also, this gene is down-regulated during transformation of normal myoblasts to rhabdomyosarcoma cells and the encoded protein may function as a link between presenilin-2 and an intracellular signaling pathway. Multiple alternatively spliced variants encoding different isoforms have been identified. [provided by RefSeq, Jan 2016]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:FHL2 (NM_201555) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH300398 FHL2 MS Standard C13 and N15-labeled recombinant protein (NP_963851) 10 ug
$3,255.00
PH319762 FHL2 MS Standard C13 and N15-labeled recombinant protein (NP_001034581) 10 ug
$3,255.00
PH320344 FHL2 MS Standard C13 and N15-labeled recombinant protein (NP_001441) 10 ug
$3,255.00
LC404459 FHL2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC404460 FHL2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC419930 FHL2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422060 FHL2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY404459 Transient overexpression lysate of four and a half LIM domains 2 (FHL2), transcript variant 2 100 ug
$436.00
LY404460 Transient overexpression lysate of four and a half LIM domains 2 (FHL2), transcript variant 4 100 ug
$436.00
LY419930 Transient overexpression lysate of four and a half LIM domains 2 (FHL2), transcript variant 1 100 ug
$436.00
LY422060 Transient overexpression lysate of four and a half LIM domains 2 (FHL2), transcript variant 5 100 ug
$436.00
TP300398 Purified recombinant protein of Homo sapiens four and a half LIM domains 2 (FHL2), transcript variant 4, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP319762 Purified recombinant protein of Homo sapiens four and a half LIM domains 2 (FHL2), transcript variant 5, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP320344 Purified recombinant protein of Homo sapiens four and a half LIM domains 2 (FHL2), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP320395 Recombinant protein of human four and a half LIM domains 2 (FHL2), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP760738 Purified recombinant protein of Human four and a half LIM domains 2 (FHL2), transcript variant 5, with N-terminal HIS tag, expressed in E.Coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.