HP1 gamma (CBX3) (NM_016587) Human Mass Spec Standard

SKU PH320388

CBX3 MS Standard C13 and N15-labeled recombinant protein (NP_057671)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC220388]
• Predicted MW: 20.8 kDa
• Protein Sequence:
  Protein Sequence

  >RC220388 protein sequence; Red=Cloning site Green=Tags(s); ; MASNKTTLQKMGKKQNGKSKKVEEAEPEEFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCP; ELIEAFLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDAADKPRGFARGLDPERIIGATDSSGELMFLM; KWKDSDEADLVLAKEANMKCPQIVIAFYEERLTWHSCPEDEAQ; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_057671
• RefSeq Size: 2102
• RefSeq ORF: 549
• Synonyms: HECH; HP1-GAMMA; HP1Hs-gamma
• Locus ID: 11335
• UniProt ID: Q13185
• Cytogenetics: 7p15.2
• Summary: At the nuclear envelope, the nuclear lamina and heterochromatin are adjacent to the inner nuclear membrane. The protein encoded by this gene binds DNA and is a component of heterochromatin. This protein also can bind lamin B receptor, an integral membrane protein found in the inner nuclear membrane. The dual binding functions of the encoded protein may explain the association of heterochromatin with the inner nuclear membrane. This protein binds histone H3 tails methylated at Lys-9 sites. This protein is also recruited to sites of ultraviolet-induced DNA damage and double-strand breaks. Two transcript variants encoding the same protein but differing in the 5' UTR, have been found for this gene.[provided by RefSeq, Mar 2011]
• Protein Families: Druggable Genome, Transcription Factors