PSD3 (NM_206909) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC220354] |
Predicted MW | 57.9 kDa |
Protein Sequence |
Protein Sequence
>RC220354 representing NM_206909
Red=Cloning site Green=Tags(s) MGSSWCLYGCCNAGVKTTRLEAHSEMGSTEILEKETPENLSNGTSSNVEAAKRLAKRLYQLDRFKRSDVA KHLGKNNEFSKLVAEEYLKFFDFTGMTLDQSLRYFFKAFSLVGETQERERVLIHFSNRYFYCNPDTIASQ DGVHCLTCAIMLLNTDLHGHNIGKKMTCQEFIANLQGVNEGVDFSKDLLKALYNSIKNEKLEWAVDDEEK KKSPSESTEEKANGTHPKTISRIGSTTNPFLDIPHDPNAAVYKSGFLARKIHADMDGKKTPRGKRGWKTF YAVLKGTVLYLQKDEYKPEKALSEEDLKNAVSVHHALASKATDYEKKPNVFKLKTADWRVLLFQTQSPEE MQGWINKINCVAAVFSAPPFPAAIGSQKKFSRPLLPATTTKLSQEEQLKSHESKLKQITTELAEHRSYPP DKKVKAKDVDEYKLKDHYLEFEKTRYEMYVSILKEGGKELLSNDESEAAGLKKSHSSPSLNPDTSPITAK VKRNVSERKDHRPETPSIKQKVT myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_996792 |
RefSeq Size | 6822 |
RefSeq ORF | 1539 |
Synonyms | EFA6D; EFA6R; HCA67 |
Locus ID | 23362 |
UniProt ID | Q9NYI0 |
Cytogenetics | 8p22 |
Summary | Guanine nucleotide exchange factor for ARF6.[UniProtKB/Swiss-Prot Function] |
Protein Pathways | Endocytosis |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH320303 | PSD3 MS Standard C13 and N15-labeled recombinant protein (NP_056125) | 10 ug |
$3,255.00
|
|
LC404163 | PSD3 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC414642 | PSD3 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LY404163 | Transient overexpression lysate of pleckstrin and Sec7 domain containing 3 (PSD3), transcript variant 2 | 100 ug |
$665.00
|
|
LY414642 | Transient overexpression lysate of pleckstrin and Sec7 domain containing 3 (PSD3), transcript variant 1 | 100 ug |
$665.00
|
|
TP320303 | Recombinant protein of human pleckstrin and Sec7 domain containing 3 (PSD3), transcript variant 1, 20 µg | 20 ug |
$867.00
|
|
TP320354 | Purified recombinant protein of Homo sapiens pleckstrin and Sec7 domain containing 3 (PSD3), transcript variant 2, 20 µg | 20 ug |
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.