PSD3 (NM_206909) Human Mass Spec Standard

SKU
PH320354
PSD3 MS Standard C13 and N15-labeled recombinant protein (NP_996792)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC220354]
Predicted MW 57.9 kDa
Protein Sequence
Protein Sequence
>RC220354 representing NM_206909
Red=Cloning site Green=Tags(s)

MGSSWCLYGCCNAGVKTTRLEAHSEMGSTEILEKETPENLSNGTSSNVEAAKRLAKRLYQLDRFKRSDVA
KHLGKNNEFSKLVAEEYLKFFDFTGMTLDQSLRYFFKAFSLVGETQERERVLIHFSNRYFYCNPDTIASQ
DGVHCLTCAIMLLNTDLHGHNIGKKMTCQEFIANLQGVNEGVDFSKDLLKALYNSIKNEKLEWAVDDEEK
KKSPSESTEEKANGTHPKTISRIGSTTNPFLDIPHDPNAAVYKSGFLARKIHADMDGKKTPRGKRGWKTF
YAVLKGTVLYLQKDEYKPEKALSEEDLKNAVSVHHALASKATDYEKKPNVFKLKTADWRVLLFQTQSPEE
MQGWINKINCVAAVFSAPPFPAAIGSQKKFSRPLLPATTTKLSQEEQLKSHESKLKQITTELAEHRSYPP
DKKVKAKDVDEYKLKDHYLEFEKTRYEMYVSILKEGGKELLSNDESEAAGLKKSHSSPSLNPDTSPITAK
VKRNVSERKDHRPETPSIKQKVT

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_996792
RefSeq Size 6822
RefSeq ORF 1539
Synonyms EFA6D; EFA6R; HCA67
Locus ID 23362
UniProt ID Q9NYI0
Cytogenetics 8p22
Summary Guanine nucleotide exchange factor for ARF6.[UniProtKB/Swiss-Prot Function]
Protein Pathways Endocytosis
Write Your Own Review
You're reviewing:PSD3 (NM_206909) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH320303 PSD3 MS Standard C13 and N15-labeled recombinant protein (NP_056125) 10 ug
$3,255.00
LC404163 PSD3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC414642 PSD3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY404163 Transient overexpression lysate of pleckstrin and Sec7 domain containing 3 (PSD3), transcript variant 2 100 ug
$665.00
LY414642 Transient overexpression lysate of pleckstrin and Sec7 domain containing 3 (PSD3), transcript variant 1 100 ug
$665.00
TP320303 Recombinant protein of human pleckstrin and Sec7 domain containing 3 (PSD3), transcript variant 1, 20 µg 20 ug
$867.00
TP320354 Purified recombinant protein of Homo sapiens pleckstrin and Sec7 domain containing 3 (PSD3), transcript variant 2, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.