PPFIBP1 (NM_003622) Human Mass Spec Standard

SKU
PH320285
PPFIBP1 MS Standard C13 and N15-labeled recombinant protein (NP_003613)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC220285]
Predicted MW 113 kDa
Protein Sequence
Protein Sequence
>RC220285 representing NM_003622
Red=Cloning site Green=Tags(s)

MMSDASDMLAAALEQMDGIIAGSKALEYSNGIFDCQSPTSPFMGSLRALHLVEDLRGLLEMMETDEKEGL
RCQIPDSTAETLVEWLQSQMTNGHLPGNGDVYQERLARLENDKESLVLQVSVLTDQVEAQGEKIRDLEFC
LEEHREKLNATEEMLQQELLSRTSLETQKLDLMAEISNLKLKLTAVEKDRLDYEDKFRDTEGLIQEINDL
RLKVSEMDSERLQYEKKLKSTKDELASLKEQLEEKESEVKRLQEKLVCKMKGEGVEIVDRDENFKKKLKE
KNIEVQKMKKAVESLMAANEEKDRKIEDLRQCLNRYKKMQDTVVLAQGKKGKDGEYEELLNSSSISSLLD
AQGFSDLEKSPSPTPVMGSPSCDPFNTSVPEEFHTTILQVSIPSLLPATVSMETSEKSKLTPKPETSFEE
NDGNIILGATVDTQLCDKLLTSSLQKSSSLGNLKKETSDGEKETIQKTSEDRAPAESRPFGTLPPRPPGQ
DTSMDDNPFGTRKVRSSFGRGFFKIKSNKRTASAPNLDRKRSASAPTLAETEKETAEHLDLAGASSRPKD
SQRNSPFQIPPPSPDSKKKSRGIMKLFGKLRRSQSTTFNPDDMSEPEFKRGGTRATAGPRLGWSRDLGQS
NSDLDMPFAKWTKEQVCNWLMEQGLGSYLNSGKHWIASGQTLLQASQQDLEKELGIKHSLHRKKLQLALQ
ALGSEEETNHGKLDFNWVTRWLDDIGLPQYKTQFDEGRVDGRMLHYMTVDDLLSLKVVSVLHHLSIKRAI
QVLRINNFEPNCLRRRPSDENTIAPSEVQKWTNHRVMEWLRSVDLAEYAPNLRGSGVHGGLMVLEPRFNV
ETMAQLLNIPPNKTLLRRHLATHFNLLIGAEAQHQKRDAMELPDYVLLTATAKVKPKKLAFSNFGNLRKK
KQEDGEEYVCPMELGQASGSASKKGFKPGLDMHLYEEDDLDRLEQMEDSEGTVRQIGAFSEGINNLTHML
KEDDMFKDFAARSPSASITDEDSNV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003613
RefSeq Size 6076
RefSeq ORF 3015
Synonyms hSGT2; hSgt2p; L2; SGT2
Locus ID 8496
UniProt ID Q86W92
Cytogenetics 12p11.23-p11.22
Summary The protein encoded by this gene is a member of the LAR protein-tyrosine phosphatase-interacting protein (liprin) family. Liprins interact with members of LAR family of transmembrane protein tyrosine phosphatases, which are known to be important for axon guidance and mammary gland development. It has been proposed that liprins are multivalent proteins that form complex structures and act as scaffolds for the recruitment and anchoring of LAR family of tyrosine phosphatases. This protein was found to interact with S100A4, a calcium-binding protein related to tumor invasiveness and metastasis. In vitro experiment demonstrated that the interaction inhibited the phosphorylation of this protein by protein kinase C and protein kinase CK2. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:PPFIBP1 (NM_003622) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC406168 PPFIBP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC418540 PPFIBP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY406168 Transient overexpression lysate of PTPRF interacting protein, binding protein 1 (liprin beta 1) (PPFIBP1), transcript variant 2 100 ug
$436.00
LY418540 Transient overexpression lysate of PTPRF interacting protein, binding protein 1 (liprin beta 1) (PPFIBP1), transcript variant 1 100 ug
$665.00
TP320285 Recombinant protein of human PTPRF interacting protein, binding protein 1 (liprin beta 1) (PPFIBP1), transcript variant 1, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.