OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Ephrin B2 (EFNB2) (NM_004093) Human Mass Spec Standard

Be the first to review this product
SKU
PH320133
EFNB2 MS Standard C13 and N15-labeled recombinant protein (NP_004084)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY418220 Transient overexpression lysate of ephrin-B2 (EFNB2) (as WB positive control) 100 ug
$436.00

Other products for "Ephrin B2 or NM_004093"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC220133
Predicted MW 36.7 kDa
Protein Sequence
Protein Sequence
>RC220133 representing NM_004093
Red=Cloning site Green=Tags(s)

MAVRRDSVWKYCWGVLMVLCRTAISKSIVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDIICPKVDSKTV
GQYEYYKVYMVDKDQADRCTIKKENTPLLNCAKPDQDIKFTIKFQEFSPNLWGLEFQKNKDYYIISTSNG
SLEGLDNQEGGVCQTRAMKILMKVGQDASSAGSTRNKDPTRRPELEAGTNGRSSTTSPFVKPNPGSSTDG
NSAGHSGNNILGSEVALFAGIASGCIIFIVIIITLVVLLLKYRRRHRKHSPQHTTTLSLSTLATPKRSGN
NNGSEPSDIIIPLRTADSVFCPHYEKVSGDYGHPVYIVQEMPPQSPANIYYKV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004084
RefSeq Size 4335
RefSeq ORF 999
Synonyms EPLG5; Htk-L; HTKL; LERK5
Locus ID 1948
UniProt ID P52799
Cytogenetics 13q33.3
Summary This gene encodes a member of the ephrin (EPH) family. The ephrins and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, especially in the nervous system and in erythropoiesis. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. This gene encodes an EFNB class ephrin which binds to the EPHB4 and EPHA3 receptors. provided by RefSeq, Jul 2008
Protein Families Druggable Genome, Transmembrane
Protein Pathways Axon guidance
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Ephrin B2" proteins (4)
SKU Description Size Price
LC418220 Lyophilized EFNB2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418220 Transient overexpression lysate of ephrin-B2 (EFNB2) (as WB positive control) 100 ug
$436.00
TP320133 Recombinant protein of human ephrin-B2 (EFNB2), 20 µg 20 ug
$867.00
TP720391 Recombinant protein of human ephrin-B2 (EFNB2) 10 ug
$160.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products