PF4V1 (NM_002620) Human Mass Spec Standard

SKU
PH320116
PF4V1 MS Standard C13 and N15-labeled recombinant protein (NP_002611)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC220116]
Predicted MW 11.6 kDa
Protein Sequence
Protein Sequence
>RC220116 protein sequence
Red=Cloning site Green=Tags(s)

MSSAARSRLTRATRQEMLFLALLLLPVVVAFARAEAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHC
PTAQLIATLKNGRKICLDLQALLYKKIIKEHLES

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002611
RefSeq Size 741
RefSeq ORF 312
Synonyms CXCL4L1; CXCL4V1; PF4-ALT; PF4A; SCYB4V1
Locus ID 5197
UniProt ID P10720
Cytogenetics 4q13.3
Summary The protein encoded by this gene is a chemokine that is highly similar to platelet factor 4. The encoded protein displays a strong antiangiogenic function and is regulated by chemokine (C-X-C motif) receptor 3. This protein also impairs tumor growth and can protect against blood-retinal barrier breakdown in diabetes patients. [provided by RefSeq, Nov 2015]
Protein Families Secreted Protein
Protein Pathways Chemokine signaling pathway, Cytokine-cytokine receptor interaction
Write Your Own Review
You're reviewing:PF4V1 (NM_002620) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC419209 PF4V1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY419209 Transient overexpression lysate of platelet factor 4 variant 1 (PF4V1) 100 ug
$436.00
TP320116 Recombinant protein of human platelet factor 4 variant 1 (PF4V1), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.