Achaete scute homolog 3 (ASCL3) (NM_020646) Human Mass Spec Standard

SKU
PH320042
ASCL3 MS Standard C13 and N15-labeled recombinant protein (NP_065697)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC220042]
Predicted MW 20.7 kDa
Protein Sequence
Protein Sequence
>RC220042 representing NM_020646
Red=Cloning site Green=Tags(s)

MMDNRGNSSLPDKLPIFPDSARLPLTRSFYLEPMVTFHVHPEAPVSSPYSEELPRLPFPSDSLILGNYSE
PCPFSFPMPYPNYRGCEYSYGPAFTRKRNERERQRVKCVNEGYAQLRHHLPEEYLEKRLSKVETLRAAIK
YINYLQSLLYPDKAETKNNPGKVSSMIATTSHHADPMFRIV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_065697
RefSeq Size 650
RefSeq ORF 543
Synonyms bHLHa42; HASH3; SGN1
Locus ID 56676
UniProt ID Q9NQ33
Cytogenetics 11p15.4
Summary Basic helix-loop-helix transcription factors, such as ASCL3, are essential for the determination of cell fate and the development and differentiation of numerous tissues (Jonsson et al., 2004 [PubMed 15475265]).[supplied by OMIM, Mar 2008]
Write Your Own Review
You're reviewing:Achaete scute homolog 3 (ASCL3) (NM_020646) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC412408 ASCL3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY412408 Transient overexpression lysate of achaete-scute complex homolog 3 (Drosophila) (ASCL3) 100 ug
$436.00
TP320042 Recombinant protein of human achaete-scute complex homolog 3 (Drosophila) (ASCL3), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.