LHFPL3 (NM_199000) Human Mass Spec Standard

SKU
PH320013
LHFPL3 MS Standard C13 and N15-labeled recombinant protein (NP_945351)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC220013]
Predicted MW 25.8 kDa
Protein Sequence
Protein Sequence
>RC220013 protein sequence
Red=Cloning site Green=Tags(s)

MPGAAAAAAAAAAAMLPTQEAAKLYHTNYVRNSRAIGVLWAIFTICFAIVNVVCFIQPYWIGDGVDTPQA
GYFGLFHYCIGNGFSRELTCRGSFTDFSTLPSGAFKAASFFIGLSMMLIIACIICFTLFFFCNTATVYKI
CAWMQLTSAACLVLGCMIFPDGWDSDEVKRMCGEKTDKYTLGACSVRWAYILAIIGILDALILSFLAFVL
GNRQDSLMAEELKAENKVLLSQYSLE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_945351
RefSeq Size 3191
RefSeq ORF 708
Synonyms LHFPL4
Locus ID 375612
UniProt ID Q86UP9
Cytogenetics 7q22.2-q22.3
Summary This gene is a member of the lipoma HMGIC fusion partner (LHFP) gene family, which is a subset of the superfamily of tetraspan transmembrane protein encoding genes. Mutations in one LHFP-like gene result in deafness in humans and mice, and a second LHFP-like gene is fused to a high-mobility group gene in a translocation-associated lipoma. A partial gene fragment named LHFPL4 corresponds to a portion of the first exon of this gene. [provided by RefSeq, Jul 2008]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:LHFPL3 (NM_199000) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC404712 LHFPL3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY404712 Transient overexpression lysate of lipoma HMGIC fusion partner-like 3 (LHFPL3) 100 ug
$436.00
TP320013 Recombinant protein of human lipoma HMGIC fusion partner-like 3 (LHFPL3), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.