OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

BFSP2 (NM_003571) Human Mass Spec Standard

Be the first to review this product
SKU
PH319996
BFSP2 MS Standard C13 and N15-labeled recombinant protein (NP_003562)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA804351 BFSP2 mouse monoclonal antibody, clone OTI4E7 (formerly 4E7)
100 ul
$447.00
LY418579 Transient overexpression lysate of beaded filament structural protein 2, phakinin (BFSP2) (as WB positive control)
100 ug
$436.00

Other products for "BFSP2 or NM_003571"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC219996
Predicted MW 45.9 kDa
Protein Sequence
Protein Sequence
>RC219996 protein sequence
Red=Cloning site Green=Tags(s)

MSERRVVVDLPTSASSSMPLQRRRASFRGPRSSSSLESPPASRTNAMSGLVRAPGVYVGTAPSGCIGGLG
ARVTRRALGISSVFLQGLRSSGLATVPAPGLERDHGAVEDLGGCLVEYMAKVHALEQVSQELETQLRMHL
ESKATRSGNWGALRASWASSCQQVGEAVLENARLMLQTETIQAGADDFKERYENEQPFRKAAEEEINSLY
KVIDEANLTKMDLESQIESLKEELGSLSRNYEEDVKLLHKQLAGCELEQMDAPIGTGLDDILETIRIQWE
RDVEKNRVEAGALLQAKQQAEVAHMSQTQEEKLAAALRVELHNTSCQVQSLQAETESLRALKRGLENTLH
DAKHWHDMELQNLGAVVGRLEAELREIRAEAEQQQQERAHLLARKCQLQKDVASYHALLDREESG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003562
RefSeq Size 1595
RefSeq ORF 1245
Synonyms CP47; CP49; CTRCT12; LIFL-L; PHAKOSIN
Locus ID 8419
UniProt ID Q13515
Cytogenetics 3q22.1
Summary More than 99% of the vertebrate ocular lens is comprised of terminally differentiated lens fiber cells. Two lens-specific intermediate filament-like proteins, the protein product of this gene (phakinin), and filensin, are expressed only after fiber cell differentiation has begun. Both proteins are found in a structurally unique cytoskeletal element that is referred to as the beaded filament (BF). Mutations in this gene have been associated with juvenile-onset, progressive cataracts and Dowling-Meara epidermolysis bullosa simplex. provided by RefSeq, Jun 2009
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "BFSP2" proteins (3)
SKU Description Size Price
LC418579 Lyophilized BFSP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418579 Transient overexpression lysate of beaded filament structural protein 2, phakinin (BFSP2) (as WB positive control) 100 ug
$436.00
TP319996 Recombinant protein of human beaded filament structural protein 2, phakinin (BFSP2), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products