IKZF3 (NM_183231) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC219750] |
Predicted MW | 46.8 kDa |
Protein Sequence |
Protein Sequence
>RC219750 representing NM_183231
Red=Cloning site Green=Tags(s) MEDIQTNAELKSTQEQSVPAESAAVLNDYSLTKSHEMENVDSGEGPANEDEDIGDDSMKVKDEYSERDEN VLKSEPMGNAEEPEIPYSYSREYNEYENIKLERHVVSFDSSRPTSGKMNCDVCGLSCISFNVLMVHKRSH TASAEARHIKAEMGSERALVLDRLASNVAKRKSSMPQKFIGEKRHCFDVNYNSSYMYEKESELIQTRMMD QAINNAISYLGAEALRPLVQTPPAPTSEMVPVISSMYPIALTRAEMSNGAPQELEKKSIHLPEKSVPSER GLSPNNSGHDSTDTDSNHEERQNHIYQQNHMVLSRARNGMPLLKEVPRSYELLKPPPICPRDSVKVINKE GEVMDVYRCDHCRVLFLDYVMFTIHMGCHGFRDPFECNMCGYRSHDRYEFSSHIARGEHRALLK myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_899054 |
RefSeq Size | 2152 |
RefSeq ORF | 1242 |
Synonyms | AIO; AIOLOS; ZNFN1A3 |
Locus ID | 22806 |
UniProt ID | Q9UKT9 |
Cytogenetics | 17q12-q21.1 |
Summary | This gene encodes a member of the Ikaros family of zinc-finger proteins. Three members of this protein family (Ikaros, Aiolos and Helios) are hematopoietic-specific transcription factors involved in the regulation of lymphocyte development. This gene product is a transcription factor that is important in the regulation of B lymphocyte proliferation and differentiation. Both Ikaros and Aiolos can participate in chromatin remodeling. Regulation of gene expression in B lymphocytes by Aiolos is complex as it appears to require the sequential formation of Ikaros homodimers, Ikaros/Aiolos heterodimers, and Aiolos homodimers. Several alternative transcripts encoding different isoforms have been described, as well as some non-protein coding variants. [provided by RefSeq, Apr 2012] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH307547 | IKZF3 MS Standard C13 and N15-labeled recombinant protein (NP_036613) | 10 ug |
$3,255.00
|
|
LC402225 | IKZF3 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC405188 | IKZF3 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC405192 | IKZF3 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC430651 | IKZF3 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY402225 | Transient overexpression lysate of IKAROS family zinc finger 3 (Aiolos) (IKZF3), transcript variant 1 | 100 ug |
$436.00
|
|
LY405188 | Transient overexpression lysate of IKAROS family zinc finger 3 (Aiolos) (IKZF3), transcript variant 2 | 100 ug |
$665.00
|
|
LY405192 | Transient overexpression lysate of IKAROS family zinc finger 3 (Aiolos) (IKZF3), transcript variant 6 | 100 ug |
$665.00
|
|
LY430651 | Transient overexpression lysate of IKAROS family zinc finger 3 (Aiolos) (IKZF3), transcript variant 6 | 100 ug |
$436.00
|
|
TP307547 | Recombinant protein of human IKAROS family zinc finger 3 (Aiolos) (IKZF3), transcript variant 1, 20 µg | 20 ug |
$867.00
|
|
TP319750 | Recombinant protein of human IKAROS family zinc finger 3 (Aiolos) (IKZF3), transcript variant 5, 20 µg | 20 ug |
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.