IKZF3 (NM_183231) Human Mass Spec Standard

SKU
PH319750
IKZF3 MS Standard C13 and N15-labeled recombinant protein (NP_899054)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC219750]
Predicted MW 46.8 kDa
Protein Sequence
Protein Sequence
>RC219750 representing NM_183231
Red=Cloning site Green=Tags(s)

MEDIQTNAELKSTQEQSVPAESAAVLNDYSLTKSHEMENVDSGEGPANEDEDIGDDSMKVKDEYSERDEN
VLKSEPMGNAEEPEIPYSYSREYNEYENIKLERHVVSFDSSRPTSGKMNCDVCGLSCISFNVLMVHKRSH
TASAEARHIKAEMGSERALVLDRLASNVAKRKSSMPQKFIGEKRHCFDVNYNSSYMYEKESELIQTRMMD
QAINNAISYLGAEALRPLVQTPPAPTSEMVPVISSMYPIALTRAEMSNGAPQELEKKSIHLPEKSVPSER
GLSPNNSGHDSTDTDSNHEERQNHIYQQNHMVLSRARNGMPLLKEVPRSYELLKPPPICPRDSVKVINKE
GEVMDVYRCDHCRVLFLDYVMFTIHMGCHGFRDPFECNMCGYRSHDRYEFSSHIARGEHRALLK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_899054
RefSeq Size 2152
RefSeq ORF 1242
Synonyms AIO; AIOLOS; ZNFN1A3
Locus ID 22806
UniProt ID Q9UKT9
Cytogenetics 17q12-q21.1
Summary This gene encodes a member of the Ikaros family of zinc-finger proteins. Three members of this protein family (Ikaros, Aiolos and Helios) are hematopoietic-specific transcription factors involved in the regulation of lymphocyte development. This gene product is a transcription factor that is important in the regulation of B lymphocyte proliferation and differentiation. Both Ikaros and Aiolos can participate in chromatin remodeling. Regulation of gene expression in B lymphocytes by Aiolos is complex as it appears to require the sequential formation of Ikaros homodimers, Ikaros/Aiolos heterodimers, and Aiolos homodimers. Several alternative transcripts encoding different isoforms have been described, as well as some non-protein coding variants. [provided by RefSeq, Apr 2012]
Write Your Own Review
You're reviewing:IKZF3 (NM_183231) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH307547 IKZF3 MS Standard C13 and N15-labeled recombinant protein (NP_036613) 10 ug
$3,255.00
LC402225 IKZF3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC405188 IKZF3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC405192 IKZF3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC430651 IKZF3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402225 Transient overexpression lysate of IKAROS family zinc finger 3 (Aiolos) (IKZF3), transcript variant 1 100 ug
$436.00
LY405188 Transient overexpression lysate of IKAROS family zinc finger 3 (Aiolos) (IKZF3), transcript variant 2 100 ug
$665.00
LY405192 Transient overexpression lysate of IKAROS family zinc finger 3 (Aiolos) (IKZF3), transcript variant 6 100 ug
$665.00
LY430651 Transient overexpression lysate of IKAROS family zinc finger 3 (Aiolos) (IKZF3), transcript variant 6 100 ug
$436.00
TP307547 Recombinant protein of human IKAROS family zinc finger 3 (Aiolos) (IKZF3), transcript variant 1, 20 µg 20 ug
$867.00
TP319750 Recombinant protein of human IKAROS family zinc finger 3 (Aiolos) (IKZF3), transcript variant 5, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.