CCDC159 (NM_001080503) Human Mass Spec Standard

SKU
PH319680
CCDC159 MS Standard C13 and N15-labeled recombinant protein (NP_001073972)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC219680]
Predicted MW 33.5 kDa
Protein Sequence
Protein Sequence
>RC219680 representing NM_001080503
Red=Cloning site Green=Tags(s)

MGEHEQVKPLETSSSKVKAKTIVMIPDSQKLLRCELESLKSQLQAQTKAFEFLNHSVTMLEKESCLQQIK
IQQLEEVLSPTGRQGEKEEHKWGMEQGRQELYGALTQGLQGLEKTLRDSEEMQRARTTRCLQLLAQEIRD
SKKFLWEELELVREEVTFIYQKLQAQEDEISENLVNIQKMQKTQVKCRKILTKMKQQGHETAACPETEEI
PQGASGCWKDDLQKELSDIWSAVHVLQNSIDSLTLCSGACPKASSLRGHKGHQCLSPPLPSWDSDSDCDQ
DLSQPPFSKSGRSFPPA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001073972
RefSeq Size 2238
RefSeq ORF 891
Locus ID 126075
UniProt ID P0C7I6
Cytogenetics 19p13.2
Write Your Own Review
You're reviewing:CCDC159 (NM_001080503) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC421058 CCDC159 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY421058 Transient overexpression lysate of coiled-coil domain containing 159 (CCDC159) 100 ug
$436.00
TP319680 Recombinant protein of human coiled-coil domain-containing-like (LOC126075), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.