OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CCDC159 (NM_001080503) Human Mass Spec Standard

Be the first to review this product
SKU
PH319680
CCDC159 MS Standard C13 and N15-labeled recombinant protein (NP_001073972)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA334117 Rabbit Polyclonal Anti-CCDC159 Antibody
100 ul
$585.00
LY421058 Transient overexpression lysate of coiled-coil domain containing 159 (CCDC159) (as WB positive control) 100 ug
$436.00

Other products for "CCDC159 or NM_001080503"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC219680
Predicted MW 33.5 kDa
Protein Sequence
Protein Sequence
>RC219680 representing NM_001080503
Red=Cloning site Green=Tags(s)

MGEHEQVKPLETSSSKVKAKTIVMIPDSQKLLRCELESLKSQLQAQTKAFEFLNHSVTMLEKESCLQQIK
IQQLEEVLSPTGRQGEKEEHKWGMEQGRQELYGALTQGLQGLEKTLRDSEEMQRARTTRCLQLLAQEIRD
SKKFLWEELELVREEVTFIYQKLQAQEDEISENLVNIQKMQKTQVKCRKILTKMKQQGHETAACPETEEI
PQGASGCWKDDLQKELSDIWSAVHVLQNSIDSLTLCSGACPKASSLRGHKGHQCLSPPLPSWDSDSDCDQ
DLSQPPFSKSGRSFPPA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001073972
RefSeq Size 2238
RefSeq ORF 891
Locus ID 126075
UniProt ID P0C7I6
Cytogenetics 19p13.2
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CCDC159" proteins (3)
SKU Description Size Price
LC421058 Lyophilized CCDC159 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY421058 Transient overexpression lysate of coiled-coil domain containing 159 (CCDC159) (as WB positive control) 100 ug
$436.00
TP319680 Recombinant protein of human coiled-coil domain-containing-like (LOC126075), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products