DPP3 (NM_005700) Human Mass Spec Standard

SKU
PH319658
DPP3 MS Standard C13 and N15-labeled recombinant protein (NP_005691)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC219658]
Predicted MW 82.4 kDa
Protein Sequence
Protein Sequence
>RC219658 representing NM_005700
Red=Cloning site Green=Tags(s)

MADTQYILPNDIGVSSLDCREAFRLLSPTERLYAYHLSRAAWYGGLAVLLQTSPEAPYIYALLSRLFRAQ
DPDQLRQHALAEGLTEEEYQAFLVYAAGVYSNMGNYKSFGDTKFVPNLPKEKLERVILGSEAAQQHPEEV
RGLWQTCGELMFSLEPRLRHLGLGKEGITTYFSGNCTMEDAKLAQDFLDSQNLSAYNTRLFKEVDGEGKP
YYEVRLASVLGSEPSLDSEVTSKLKSYEFRGSPFQVTRGDYAPILQKVVEQLEKAKAYAANSHQGQMLAQ
YIESFTQGSIEAHKRGSRFWIQDKGPIVESYIGFIESYRDPFGSRGEFEGFVAVVNKAMSAKFERLVASA
EQLLKELPWPPTFEKDKFLTPDFTSLDVLTFAGSGIPAGINIPNYDDLRQTEGFKNVSLGNVLAVAYATQ
REKLTFLEEDDKDLYILWKGPSFDVQVGLHELLGHGSGKLFVQDEKGAFNFDQETVINPETGEQIQSWYR
SGETWDSKFSTIASSYEECRAESVGLYLCLHPQVLEIFGFEGADAEDVIYVNWLNMVRAGLLALEFYTPE
AFNWRQAHMQARFVILRVLLEAGEGLVTITPTTGSDGRPDARVRLDRSKIRSVGKPALERFLRRLQVLKS
TGDVAGGRALYEGYATVTDAPPECFLTLRDTVLLRKESRKLIVQPNTRLEGSDVQLLEYEASAAGLIRSF
SERFPEDGPELEEILTQLATADARFWKGPSEAPSGQA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005691
RefSeq Size 2684
RefSeq ORF 2211
Synonyms DPPIII
Locus ID 10072
UniProt ID Q9NY33
Cytogenetics 11q13.2
Summary This gene encodes a protein that is a member of the M49 family of metallopeptidases. This cytoplasmic protein binds a single zinc ion with its zinc-binding motif (HELLGH) and has post-proline dipeptidyl aminopeptidase activity, cleaving Xaa-Pro dipeptides from the N-termini of proteins. Increased activity of this protein is associated with endometrial and ovarian cancers. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Feb 2012]
Protein Families Druggable Genome, Protease
Write Your Own Review
You're reviewing:DPP3 (NM_005700) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH303406 DPP3 MS Standard C13 and N15-labeled recombinant protein (NP_569710) 10 ug
$3,255.00
LC408959 DPP3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC417120 DPP3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY408959 Transient overexpression lysate of dipeptidyl-peptidase 3 (DPP3), transcript variant 2 100 ug
$436.00
LY417120 Transient overexpression lysate of dipeptidyl-peptidase 3 (DPP3), transcript variant 1 100 ug
$436.00
TP303406 Recombinant protein of human dipeptidyl-peptidase 3 (DPP3), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP319658 Recombinant protein of human dipeptidyl-peptidase 3 (DPP3), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP721179 Purified recombinant protein of Human dipeptidyl-peptidase 3 (DPP3), transcript variant 2 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.