Pepsin (PGA4) (NM_001079808) Human Mass Spec Standard

SKU
PH319574
PGA4 MS Standard C13 and N15-labeled recombinant protein (NP_001073276)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC219574]
Predicted MW 42 kDa
Protein Sequence
Protein Sequence
>Peptide sequence encoded by RC219574
Blue=ORF Red=Cloning site Green=Tag(s)

MKWLLLLGLVALSECIMYKVPLIRKKSLRRTLSERGLLKDFLKKHNLNPARKYFPQWEAPTLVDEQPLE
NYLDMEYFGTIGIGTPAQDFTVVFDTGSSNLWVPSVYCSSLACTNHNRFNPEDSSTYQSTSETVSITYG
TGSMTGILGYDTVQVGGISDTNQIFGLSETEPGSFLYYAPFDGILGLAYPSISSSGATPVFDNIWNQGL
VSQDLFSVYLSADDQSGSVVIFGGIDSSYYTGSLNWVPVTVEGYWQITVDSITMNGEAIACAEGCQAIV
DTGTSLLTGPTSPIANIQSDIGASENSDGDMVVSCSAISSLPDIVFTINGVQYPVPPSAYILQSEGSCI
SGFQGMNLPTESGELWILGDVFIRQYFTVFDRANNQVGLAPVA

myc-FLAG tag

Recombinant protein using RC219574 also available, TP319574
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001073276
RefSeq Size 1413
RefSeq ORF 1164
Locus ID 643847
UniProt ID P0DJD7
Cytogenetics 11q12.2
Summary This gene encodes a protein precursor of the digestive enzyme pepsin, a member of the peptidase A1 family of endopeptidases. The encoded precursor is secreted by gastric chief cells and undergoes autocatalytic cleavage in acidic conditions to form the active enzyme, which functions in the digestion of dietary proteins. This gene is found in a cluster of related genes on chromosome 11, each of which encodes one of multiple pepsinogens. Pepsinogen levels in serum may serve as a biomarker for atrophic gastritis and gastric cancer. [provided by RefSeq, Jul 2015]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:Pepsin (PGA4) (NM_001079808) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC421543 PGA4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY421543 Transient overexpression lysate of pepsinogen 4, group I (pepsinogen A) (PGA4) 100 ug
$436.00
TP319574 Recombinant protein of human pepsinogen 4, group I (pepsinogen A) (PGA4), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.