RNF135 (NM_032322) Human Mass Spec Standard

SKU
PH319438
RNF135 MS Standard C13 and N15-labeled recombinant protein (NP_115698)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC219438]
Predicted MW 47.7 kDa
Protein Sequence
Protein Sequence
>RC219438 representing NM_032322
Red=Cloning site Green=Tags(s)

MAGLGLGSAVPVWLAEDDLGCIICQGLLDWPATLPCGHSFCRHCLEALWGARDARRWACPTCRQGAAQQP
HLRKNTLLQDLADKYRRAAREIQAGSDPAHCPCPGSSSLSSAAARPRRRPELQRVAVEKSITEVAQELTE
LVEHLVDIVRSLQNQRPLSESGPDNELSILGKAFSSGVDLSMASPKLVTSDTAAGKIRDILHDLEEIQEK
LQESVTWKEAPEAQMQGELLEAPSSSSCPLPDQSHPALRRASRFAQWAIHPTFNLKSLSCSLEVSKDSRT
VTVSHRPQPYRWSCERFSTSQVLCSQALSSGKHYWEVDTRNCSHWAVGVASWEMSRDQVLGRTMDSCCVE
WKGTSQLSAWHMVKETVLGSDRPGVVGIWLNLEEGKLAFYSVDNQEKLLYECTISASSPLYPAFWLYGLH
PGNYLIIKQVKV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_115698
RefSeq Size 2195
RefSeq ORF 1296
Synonyms L13; MMFD; REUL; Riplet
Locus ID 84282
UniProt ID Q8IUD6
Cytogenetics 17q11.2
Summary The protein encoded by this gene contains a RING finger domain, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. This gene is located in a chromosomal region known to be frequently deleted in patients with neurofibromatosis. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:RNF135 (NM_032322) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC410198 RNF135 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC432833 RNF135 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY410198 Transient overexpression lysate of ring finger protein 135 (RNF135), transcript variant 1 100 ug
$665.00
LY432833 Transient overexpression lysate of ring finger protein 135 (RNF135), transcript variant 3 100 ug
$436.00
TP319438 Recombinant protein of human ring finger protein 135 (RNF135), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP329833 Recombinant protein of human ring finger protein 135 (RNF135), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.