GBX1 (NM_001098834) Human Mass Spec Standard

SKU
PH319351
GBX1 MS Standard C13 and N15-labeled recombinant protein (NP_001092304)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC219351]
Predicted MW 37.4 kDa
Protein Sequence
Protein Sequence
>RC219351 representing NM_001098834
Red=Cloning site Green=Tags(s)

MQRAGGGSAPGGNGGGGGGGPGTAFSIDSLIGPPPPRSGHLLYTGYPMFMPYRPLVLPQALAPAPLPAGL
PPLAPLASFAGRLTNTFCAGLGQAVPSMVALTTALPSFAEPPDAFYGPQELAAAAAAAAATAARNNPEPG
GRRPEGGLEADELLPAREKVAEPPPPPPPHFSETFPSLPAEGKVYSSDEEKLEASAGDPAGSEQEEEGSG
GDSEDDGFLDSSAGGPGALLGPKPKLKGSLGTGAEEGAPVTAGVTAPGGKSRRRRTAFTSEQLLELEKEF
HCKKYLSLTERSQIAHALKLSEVQVKIWFQNRRAKWKRIKAGNVSSRSGEPVRNPKIVVPIPVHVNRFAV
RSQHQQMEQGARP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001092304
RefSeq Size 1324
RefSeq ORF 1089
Synonyms Huh-17
Locus ID 2636
UniProt ID Q14549
Cytogenetics 7q36.1
Write Your Own Review
You're reviewing:GBX1 (NM_001098834) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC420361 GBX1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY420361 Transient overexpression lysate of gastrulation brain homeobox 1 (GBX1) 100 ug
$436.00
TP319351 Recombinant protein of human gastrulation brain homeobox 1 (GBX1), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.