OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RNF39 (NM_025236) Human Mass Spec Standard

Be the first to review this product
SKU
PH319332
RNF39 MS Standard C13 and N15-labeled recombinant protein (NP_079512)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA505912 RNF39 mouse monoclonal antibody, clone OTI5E10 (formerly 5E10) 100 ul
$447.00
LY410747 Transient overexpression lysate of ring finger protein 39 (RNF39), transcript variant 1 (as WB positive control) 100 ug
$665.00

Other products for "RNF39 or NM_025236"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC219332
Predicted MW 45.5 kDa
Protein Sequence
Protein Sequence
>RC219332 protein sequence
Red=Cloning site Green=Tags(s)

MWWRDLTRLRLWLKREAIPGEGRKAAKVNAGVGEKGIYTASSRGGPPSARSKAVTVVAEGAASRSWLSMD
APELGPGLVERLEQLATCPLCGGSFEDPVLLACEHSFCRACLARRWGTPPATGTEASPTACPCCGLPCPR
RSLRSNVRLAVEVRISRELREKLAEPGARAGRRRGGRIPTMGCLDLPGEDMRKTWRRFEVPTSKSSNSED
DLPEDYPVVKKMLHRLTADLTLDPGTAHRRLLISADRRSVQLAPPGTPAPPDGPKRFDQLPAVLGAQGFG
AGRHCWEVETADAASCRDSSGEDADDEESHYAVGAAGESVQRKGCVRLCPAGAVWAVEGRGGRLWALTAP
EPTLLGGVEPPPRRIRVDLDWERGRVAFYDGRSLDLLYAFQAPGPLGERIFPLFCTCDPRAPLRIVPAES

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_079512
RefSeq Size 2170
RefSeq ORF 1260
Synonyms FAP216; HZF; HZFW; LIRF
Locus ID 80352
UniProt ID Q9H2S5
Cytogenetics 6p22.1
Summary This gene lies within the major histocompatibility complex class I region on chromosome 6. Studies of a similar rat protein suggest that this gene encodes a protein that plays a role in an early phase of synaptic plasticity. Multiple transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Jul 2008
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RNF39" proteins (3)
SKU Description Size Price
LC410747 Lyophilized RNF39 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY410747 Transient overexpression lysate of ring finger protein 39 (RNF39), transcript variant 1 (as WB positive control) 100 ug
$665.00
TP319332 Recombinant protein of human ring finger protein 39 (RNF39), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products