TRAF5 (NM_004619) Human Mass Spec Standard

SKU
PH319243
TRAF5 MS Standard C13 and N15-labeled recombinant protein (NP_004610)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC219243]
Predicted MW 64.4 kDa
Protein Sequence
Protein Sequence
>RC219243 protein sequence
Red=Cloning site Green=Tags(s)

MAYSEEHKGMPCGFIRQNSGNSISLDFEPSIEYQFVERLEERYKCAFCHSVLHNPHQTGCGHRFCQHCIL
SLRELNTVPICPVDKEVIKSQEVFKDNCCKREVLNLYVYCSNAPGCNAKVILGRYQDHLQQCLFQPVQCS
NEKCREPVLRKDLKEHLSASCQFRKEKCLYCKKDVVVINLQNHEENLCPEYPVFCPNNCAKIILKTEVDE
HLAVCPEAEQDCPFKHYGCAVTDKRRNLQQHEHSALREHMRLVLEKNVQLEEQISDLHKSLEQKESKIQQ
LAETIKKLEKEFKQFAQLFGKNGSFLPNIQVFASHIDKSAWLEAQVHQLLQMVNQQQNKFDLRPLMEAVD
TVKQKITLLENNDQRLAVLEEETNKHDTHINIHKAQLSKNEERFKLLEGTCYNGKLIWKVTDYKMKKREA
VDGHTVSIFSQSFYTSRCGYRLCARAYLNGDGSGRGSHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQS
GKKNIMETFKPDPNSSSFKRPDGEMNIASGCPRFVAHSVLENAKNAYIKDDTLFLKVAVDLTDLEDL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004610
RefSeq Size 3988
RefSeq ORF 1671
Synonyms MGC:39780; RNF84
Locus ID 7188
UniProt ID O00463
Cytogenetics 1q32.3
Summary The scaffold protein encoded by this gene is a member of the tumor necrosis factor receptor-associated factor (TRAF) protein family and contains a meprin and TRAF homology (MATH) domain, a RING-type zinc finger, and two TRAF-type zinc fingers. TRAF proteins are associated with, and mediate signal transduction from members of the TNF receptor superfamily. This protein is one of the components of a multiple protein complex which binds to tumor necrosis factor (TNF) receptor cytoplasmic domains and mediates TNF-induced activation. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2016]
Protein Families Druggable Genome
Protein Pathways Pathways in cancer, Small cell lung cancer
Write Your Own Review
You're reviewing:TRAF5 (NM_004619) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC407875 TRAF5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC417875 TRAF5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422427 TRAF5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY407875 Transient overexpression lysate of TNF receptor-associated factor 5 (TRAF5), transcript variant 2 100 ug
$665.00
LY417875 Transient overexpression lysate of TNF receptor-associated factor 5 (TRAF5), transcript variant 1 100 ug
$665.00
LY422427 Transient overexpression lysate of TNF receptor-associated factor 5 (TRAF5), transcript variant 3 100 ug
$436.00
TP319243 Recombinant protein of human TNF receptor-associated factor 5 (TRAF5), transcript variant 1, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.