OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

VPS13B (NM_181661) Human Mass Spec Standard

Be the first to review this product
SKU
PH319188
VPS13B MS Standard C13 and N15-labeled recombinant protein (NP_858047)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA807803 VPS13B mouse monoclonal antibody, clone OTI6D1 (formerly 6D1) 100 ul
$447.00
LY405555 Transient overexpression lysate of vacuolar protein sorting 13 homolog B (yeast) (VPS13B), transcript variant 4 (as WB positive control) 100 ug
$436.00

Other products for "VPS13B or NM_181661"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC219188
Predicted MW 47 kDa
Protein Sequence
Protein Sequence
>RC219188 representing NM_181661
Red=Cloning site Green=Tags(s)

MLESYVTPILMSYVNRYIKNLKPSDLQLSLWGGDVVLSKLELKLDVLEQELKLPFTFLSGHIHELRIHVP
WTKLGSEPVVITINTMECILKLKDGIQDDHESCGSNSTNRSTAESTKSSIKPRRMQQAAPTDPDLPPGYV
QSLIRRVVNNVNIVINNLILKYVEDDIVLSVNITSAECYTVGELWDRAFMDISATDLVLRKVINFSDCTV
CLDKRNASGKIEFYQDPLLYKCSFRTRLHFTYENLNSKMPSVIKIHTLVESLKLSITDQQLPMFIRIMQL
GIALYYGEIGNFKEGEIEDLTCHNKDMLGNITGSEDETRIDMQYPAQHKGQELYSQQDEEQPQGWVSWAW
SFVPAIVSYDDGEEDFVGNDPASTMHQQKAQTLKDPIVSIGFYCTKATVTFKVGLFSCCLYLYQL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_858047
RefSeq Size 1634
RefSeq ORF 1245
Synonyms CHS1; COH1
Locus ID 157680
UniProt ID Q7Z7G8
Cytogenetics 8q22.2
Summary This gene encodes a potential transmembrane protein that may function in vesicle-mediated transport and sorting of proteins within the cell. This protein may play a role in the development and the function of the eye, hematological system, and central nervous system. Mutations in this gene have been associated with Cohen syndrome. Multiple splice variants encoding distinct isoforms have been identified for this gene. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "VPS13B" proteins (3)
SKU Description Size Price
LC405555 Lyophilized VPS13B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY405555 Transient overexpression lysate of vacuolar protein sorting 13 homolog B (yeast) (VPS13B), transcript variant 4 (as WB positive control) 100 ug
$436.00
TP319188 Recombinant protein of human vacuolar protein sorting 13 homolog B (yeast) (VPS13B), transcript variant 4, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products