Iduronate 2 sulfatase (IDS) (NM_000202) Human Mass Spec Standard

SKU
PH319187
IDS MS Standard C13 and N15-labeled recombinant protein (NP_000193)
$3,255.00
2 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC219187]
Predicted MW 61.87 kDa
Protein Sequence
Protein Sequence
>RC219187 representing NM_000202
Red=Cloning site Green=Tags(s)

MPPPRTGRGLLWLGLVLSSVCVALGSETQANSTTDALNVLLIIVDDLRPSLGCYGDKLVRSPNIDQLASH
SLLFQNAFAQQAVCAPSRVSFLTGRRPDTTRLYDFNSYWRVHAGNFSTIPQYFKENGYVTMSVGKVFHPG
ISSNHTDDSPYSWSFPPYHPSSEKYENTKTCRGPDGELHANLLCPVDVLDVPEGTLPDKQSTEQAIQLLE
KMKTSASPFFLAVGYHKPHIPFRYPKEFQKLYPLENITLAPDPEVPDGLPPVAYNPWMDIRQREDVQALN
ISVPYGPIPVDFQRKIRQSYFASVSYLDTQVGRLLSALDDLQLANSTIIAFTSDHGWALGEHGEWAKYSN
FDVATHVPLIFYVPGRTASLPEAGEKLFPYLDPFDSASQLMEPGRQSMDLVELVSLFPTLAGLAGLQVPP
RCPVPSFHVELCREGKNLLKHFRFRDLEEDPYLPGNPRELIAYSQYPRPSDIPQWNSDKPSLKDIKIMGY
SIRTIDYRYTVWVGFNPDEFLANFSDIHAGELYFVDSDPLQDHNMYNDSQGGDLFQLLMP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_000193
RefSeq Size 2504
RefSeq ORF 1650
Synonyms ID2S; MPS2; SIDS
Locus ID 3423
UniProt ID P22304
Cytogenetics Xq28
Summary This gene encodes a member of the sulfatase family of proteins. The encoded preproprotein is proteolytically processed to generate two polypeptide chains. This enzyme is involved in the lysosomal degradation of heparan sulfate and dermatan sulfate. Mutations in this gene are associated with the X-linked lysosomal storage disease mucopolysaccharidosis type II, also known as Hunter syndrome. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed. [provided by RefSeq, Jan 2016]
Protein Families Druggable Genome
Protein Pathways Glycosaminoglycan degradation, Lysosome, Metabolic pathways
Write Your Own Review
You're reviewing:Iduronate 2 sulfatase (IDS) (NM_000202) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC416853 IDS HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC424863 IDS HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC433123 IDS HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY416853 Transient overexpression lysate of iduronate 2-sulfatase (IDS), transcript variant 2 100 ug
$436.00
LY424863 Transient overexpression lysate of iduronate 2-sulfatase (IDS), transcript variant 1 100 ug
$665.00
LY433123 Transient overexpression lysate of iduronate 2-sulfatase (IDS), transcript variant 3 100 ug
$436.00
TP319187 Recombinant protein of human iduronate 2-sulfatase (IDS), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.