CAMKK2 (NM_153499) Human Mass Spec Standard

SKU
PH319152
CAMKK2 MS Standard C13 and N15-labeled recombinant protein (NP_705719)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC219152]
Predicted MW 59.6 kDa
Protein Sequence
Protein Sequence
>RC219152 representing NM_153499
Red=Cloning site Green=Tags(s)

MSSCVSSQPSSNRAAPQDELGGRGSSSSESQKPCEALRGLSSLSIHLGMESFIVVTECEPGCAVDLGLAR
DRPLEADGQEVPLDSSGSQARPHLSGRKLSLQERSQGGLAAGGSLDMNGRCICPSLPYSPVSSPQSSPRL
PRRPTVESHHVSITGMQDCVQLNQYTLKDEIGKGSYGVVKLAYNENDNTYYAMKVLSKKKLIRQAGFPRR
PPPRGTRPAPGGCIQPRGPIEQVYQEIAILKKLDHPNVVKLVEVLDDPNEDHLYMVFELVNQGPVMEVPT
LKPLSEDQARFYFQDLIKGIEYLHYQKIIHRDIKPSNLLVGEDGHIKIADFGVSNEFKGSDALLSNTVGT
PAFMAPESLSETRKIFSGKALDVWAMGVTLYCFVFGQCPFMDERIMCLHSKIKSQALEFPDQPDIAEDLK
DLITRMLDKNPESRIVVPEIKLHPWVTRHGAEPLPSEDENCTLVEVTEEEVENSVKHIPSLATVILVKTM
IRKRSFGNPFEGSRREERSLSAPGNLLTKQGSEDNLQGTDPPPVGEEEVLL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_705719
RefSeq Size 5577
RefSeq ORF 1623
Synonyms CAMKK; CAMKKB
Locus ID 10645
UniProt ID Q96RR4
Cytogenetics 12q24.31
Summary The product of this gene belongs to the Serine/Threonine protein kinase family, and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. The major isoform of this gene plays a role in the calcium/calmodulin-dependent (CaM) kinase cascade by phosphorylating the downstream kinases CaMK1 and CaMK4. Protein products of this gene also phosphorylate AMP-activated protein kinase (AMPK). This gene has its strongest expression in the brain and influences signalling cascades involved with learning and memory, neuronal differentiation and migration, neurite outgrowth, and synapse formation. Alternative splicing results in multiple transcript variants encoding distinct isoforms. The identified isoforms differ in their ability to undergo autophosphorylation and to phosphorylate downstream kinases. [provided by RefSeq, Jul 2012]
Protein Families Druggable Genome, Protein Kinase, Transcription Factors
Protein Pathways Adipocytokine signaling pathway
Write Your Own Review
You're reviewing:CAMKK2 (NM_153499) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH303468 CAMKK2 MS Standard C13 and N15-labeled recombinant protein (NP_757380) 10 ug
$3,255.00
LC406744 CAMKK2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC406745 CAMKK2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC406746 CAMKK2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC407016 CAMKK2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC407017 CAMKK2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY406744 Transient overexpression lysate of calcium/calmodulin-dependent protein kinase kinase 2, beta (CAMKK2), transcript variant 5 100 ug
$665.00
LY406745 Transient overexpression lysate of calcium/calmodulin-dependent protein kinase kinase 2, beta (CAMKK2), transcript variant 6 100 ug
$665.00
LY406746 Transient overexpression lysate of calcium/calmodulin-dependent protein kinase kinase 2, beta (CAMKK2), transcript variant 3 100 ug
$665.00
LY407016 Transient overexpression lysate of calcium/calmodulin-dependent protein kinase kinase 2, beta (CAMKK2), transcript variant 2 100 ug
$665.00
LY407017 Transient overexpression lysate of calcium/calmodulin-dependent protein kinase kinase 2, beta (CAMKK2), transcript variant 4 100 ug
$665.00
TP303468 Recombinant protein of human calcium/calmodulin-dependent protein kinase kinase 2, beta (CAMKK2), transcript variant 7, 20 µg 20 ug
$737.00
TP319152 Recombinant protein of human calcium/calmodulin-dependent protein kinase kinase 2, beta (CAMKK2), transcript variant 2, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.