C1orf38 (THEMIS2) (NM_004848) Human Mass Spec Standard

SKU
PH319127
C1orf38 MS Standard C13 and N15-labeled recombinant protein (NP_004839)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC219127]
Predicted MW 29.1 kDa
Protein Sequence
Protein Sequence
>RC219127 protein sequence
Red=Cloning site Green=Tags(s)

MEPVPLQDFVRALDPASLPRVLRVCSGVYFEGSIYEISGNECCLSTGDLIKVTQVRLQKVVCENPKTSQT
MELAPNFQGYFTPLNTPQSYETLEELVSATTQSSKQLPTCFMSTHRIVTEGRVVTEDQLLMLEAVVMHLG
IRSARCVLGMEGQQVILHLPLSQKGPFWTWEPSAPRTLLQVLQDPALKDLVLTCPTLPWHSLILRPQYEI
QAIMHIFSSLRIAATRSAAQTQGEDLARVHQGWLQYVQQDSCPQEGPQAR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004839
RefSeq Size 1651
RefSeq ORF 780
Synonyms C1orf38; ICB-1; ICB1
Locus ID 9473
UniProt ID Q5TEJ8
Cytogenetics 1p35.3
Summary May constitute a control point in macrophage inflammatory response, promoting LPS-induced TNF production.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:C1orf38 (THEMIS2) (NM_004848) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC417704 THEMIS2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426270 THEMIS2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY417704 Transient overexpression lysate of chromosome 1 open reading frame 38 (C1orf38), transcript variant 1 100 ug
$436.00
LY426270 Transient overexpression lysate of chromosome 1 open reading frame 38 (C1orf38), transcript variant 3 100 ug
$436.00
TP319127 Recombinant protein of human chromosome 1 open reading frame 38 (C1orf38), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.