ZP2 (NM_003460) Human Mass Spec Standard

SKU
PH319115
ZP2 MS Standard C13 and N15-labeled recombinant protein (NP_003451)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC219115]
Predicted MW 82.4 kDa
Protein Sequence
Protein Sequence
>RC219115 representing NM_003460
Red=Cloning site Green=Tags(s)

MACRQRGGSWSPSGWFNAGWSTYRSISLFFALVTSVNSIDVSQLVNPAFPGTVTCDEREITVEFPSSPGT
KKWHASVVDPLGLDMPNCTYILDPEKLTLRATYDNCTRRVHGGHQMTIRVMNNSAALRHGAVMYQFFCPA
MQVEETQGLSASTICQKDFMSFSLPRVFSGLADDSKGTKVQMGWSIEVGDGARAKTLTLPEAMKEGFSLL
IDNHRMTFHVPFNATGVTHYVQGNSHLYMVSLKLTFISPGQKVIFSSQAICAPDPVTCNATHMTLTIPEF
PGKLKSVSFENQNIDVSQLHDNGIDLEATNGMKLHFSKTLLKTKLSEKCLLHQFYLASLKLTFLLRPETV
SMVIYPECLCESPVSIVTGELCTQDGFMDVEVYSYQTQPALDLGTLRVGNSSCQPVFEAQSQGLVRFHIP
LNGCGTRYKFEDDKVVYENEIHALWTDFPPSKISRDSEFRMTVKCSYSRNDMLLNINVESLTPPVASVKL
GPFTLILQSYPDNSYQQPYGENEYPLVRFLRQPIYMEVRVLNRDDPNIKLVLDDCWATSTMDPDSFPQWN
VVVDGCAYDLDNYQTTFHPVGSSVTHPDHYQRFDMKAFAFVSEAHVLSSLVYFHCSALICNRLSPDSPLC
SVTCPVSSRHRRATGATEAEKMTVSLPGPILLLSDDSSFRGVGSSDLKASGSSGEKSRSETGEEVGSRGA
MDTKGHKTAGDVGSKAVAAVAAFAGVVATLGFIYYLYEKRTVSNH

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003451
RefSeq Size 2266
RefSeq ORF 2235
Synonyms OOMD6; Zp-2; ZPA
Locus ID 7783
UniProt ID Q05996
Cytogenetics 16p12.3-p12.2
Summary The zona pellucida is an extracellular matrix that surrounds the oocyte and early embryo. It is composed of three glycoproteins with various functions during fertilization and preimplantation development. The glycosylated mature peptide is one of the structural components of the zona pellucida and functions in secondary binding and penetration of acrosome-reacted spermatozoa. Female mice lacking this gene do not form a stable zona matrix and are sterile. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2014]
Protein Families Secreted Protein, Transmembrane
Write Your Own Review
You're reviewing:ZP2 (NM_003460) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC418662 ZP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418662 Transient overexpression lysate of zona pellucida glycoprotein 2 (sperm receptor) (ZP2) 100 ug
$665.00
TP319115 Recombinant protein of human zona pellucida glycoprotein 2 (sperm receptor) (ZP2), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.