hnRNP K (HNRNPK) (NM_031263) Human Mass Spec Standard

SKU
PH319023
HNRNPK MS Standard C13 and N15-labeled recombinant protein (NP_112553)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC219023]
Predicted MW 51 kDa
Protein Sequence
Protein Sequence
>RC219023 protein sequence
Red=Cloning site Green=Tags(s)

METEQPEETFPNTETNGEFGKRPAEDMEEEQAFKRSRNTDEMVELRILLQSKNAGAVIGKGGKNIKALRT
DYNASVSVPDSSGPERILSISADIETIGEILKKIIPTLEEGLQLPSPTATSQLPLESDAVECLNYQHYKG
SDFDCELRLLIHQSLAGGIIGVKGAKIKELRENTQTTIKLFQECCPHSTDRVVLIGGKPDRVVECIKIIL
DLISESPIKGRAQPYDPNFYDETYDYGGFTMMFDDRRGRPVGFPMRGRGGFDRMPPGRGGRPMPPSRRDY
DDMSPRRGPPPPPPGRGGRGGSRARNLPLPPPPPPRGGDLMAYDRRGRPGDRYDGMVGFSADETWDSAID
TWSPSEWQMAYEPQGGSGYDYSYAGGRGSYGDLGGPIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGAS
IKIDEPLEGSEDRIITITGTQDQIQNAQYLLQNSVKQYADVEGF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_112553
RefSeq Size 2960
RefSeq ORF 1392
Synonyms AUKS; CSBP; HNRPK; TUNP
Locus ID 3190
UniProt ID P61978
Cytogenetics 9q21.32
Summary This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene is located in the nucleoplasm and has three repeats of KH domains that binds to RNAs. It is distinct among other hnRNP proteins in its binding preference; it binds tenaciously to poly(C). This protein is also thought to have a role during cell cycle progession. Several alternatively spliced transcript variants have been described for this gene, however, not all of them are fully characterized. [provided by RefSeq, Jul 2008]
Protein Pathways Spliceosome
Write Your Own Review
You're reviewing:hnRNP K (HNRNPK) (NM_031263) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH301843 HNRNPK MS Standard C13 and N15-labeled recombinant protein (NP_002131) 10 ug
$3,255.00
PH304921 HNRNPK MS Standard C13 and N15-labeled recombinant protein (NP_112552) 10 ug
$3,255.00
LC400779 HNRNPK HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC410602 HNRNPK HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC410603 HNRNPK HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400779 Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein K (HNRNPK), transcript variant 1 100 ug
$436.00
LY410602 Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein K (HNRNPK), transcript variant 3 100 ug
$436.00
LY410603 Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein K (HNRNPK), transcript variant 2 100 ug
$436.00
TP301843 Recombinant protein of human heterogeneous nuclear ribonucleoprotein K (HNRNPK), transcript variant 1, 20 µg 20 ug
$867.00
TP304921 Recombinant protein of human heterogeneous nuclear ribonucleoprotein K (HNRNPK), transcript variant 3, 20 µg 20 ug
$867.00
TP319023 Recombinant protein of human heterogeneous nuclear ribonucleoprotein K (HNRNPK), transcript variant 2, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.