bcl 6 (BCL6) (NM_001706) Human Mass Spec Standard

SKU
PH319007
BCL6 MS Standard C13 and N15-labeled recombinant protein (NP_001697)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC219007]
Predicted MW 78.7 kDa
Protein Sequence
Protein Sequence
>RC219007 representing NM_001706
Red=Cloning site Green=Tags(s)

MASPADSCIQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHKTVLMACSGLFYSIFTDQLKCNLS
VINLDPEINPEGFCILLDFMYTSRLNLREGNIMAVMATAMYLQMEHVVDTCRKFIKASEAEMVSAIKPPR
EEFLNSRMLMPQDIMAYRGREVVENNLPLRSAPGCESRAFAPSLYSGLSTPPASYSMYSHLPVSSLLFSD
EEFRDVRMPVANPFPKERALPCDSARPVPGEYSRPTLEVSPNVCHSNIYSPKETIPEEARSDMHYSVAEG
LKPAAPSARNAPYFPCDKASKEEERPSSEDEIALHFEPPNAPLNRKGLVSPQSPQKSDCQPNSPTESCSS
KNACILQASGSPPAKSPTDPKACNWKKYKFIVLNSLNQNAKPEGPEQAELGRLSPRAYTAPPACQPPMEP
ENLDLQSPTKLSASGEDSTIPQASRLNNIVNRSMTGSPRSSSESHSPLYMHPPKCTSCGSQSPQHAEMCL
HTAGPTFPEEMGETQSEYSDSSCENGAFFCNECDCRFSEEASLKRHTLQTHSDKPYKCDRCQASFRYKGN
LASHKTVHTGEKPYRCNICGAQFNRPANLKTHTRIHSGEKPYKCETCGARFVQVAHLRAHVLIHTGEKPY
PCEICGTRFRHLQTLKSHLRIHTGEKPYHCEKCNLHFRHKSQLRLHLRQKHGAITNTKVQYRVSATDLPP
ELPKAC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001697
RefSeq Size 3537
RefSeq ORF 2118
Synonyms BCL5; BCL6A; LAZ3; ZBTB27; ZNF51
Locus ID 604
UniProt ID P41182
Cytogenetics 3q27.3
Summary The protein encoded by this gene is a zinc finger transcription factor and contains an N-terminal POZ domain. This protein acts as a sequence-specific repressor of transcription, and has been shown to modulate the transcription of STAT-dependent IL-4 responses of B cells. This protein can interact with a variety of POZ-containing proteins that function as transcription corepressors. This gene is found to be frequently translocated and hypermutated in diffuse large-cell lymphoma (DLCL), and may be involved in the pathogenesis of DLCL. Alternatively spliced transcript variants encoding different protein isoforms have been found for this gene. [provided by RefSeq, Aug 2015]
Protein Families Druggable Genome, Transcription Factors
Write Your Own Review
You're reviewing:bcl 6 (BCL6) (NM_001706) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC400639 BCL6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427282 BCL6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400639 Transient overexpression lysate of B-cell CLL/lymphoma 6 (BCL6), transcript variant 1 100 ug
$665.00
LY427282 Transient overexpression lysate of B-cell CLL/lymphoma 6 (BCL6), transcript variant 2 100 ug
$665.00
TP319007 Recombinant protein of human B-cell CLL/lymphoma 6 (BCL6), transcript variant 1, 20 µg 20 ug
$867.00
TP750190 Purified recombinant protein of Human B-cell CLL/lymphoma 6 (BCL6), transcript variant 1, Ser209-Pro292, tag free, expressed in E.coli, 50ug 50 ug
$362.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.