OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

C1S (NM_001734) Human Mass Spec Standard

Be the first to review this product
SKU
PH318963
C1S MS Standard C13 and N15-labeled recombinant protein (NP_001725)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA503953 C1S mouse monoclonal antibody, clone OTI1G1 (formerly 1G1) 100 ul
$447.00
LY400655 Transient overexpression lysate of complement component 1, s subcomponent (C1S), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "C1S or NM_001734"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC218963
Predicted MW 76.68 kDa
Protein Sequence
Protein Sequence
>RC218963 representing NM_001734
Red=Cloning site Green=Tags(s)

MWCIVLFSLLAWVYAEPTMYGEILSPNYPQAYPSEVEKSWDIEVPEGYGIHLYFTHLDIELSENCAYDSV
QIISGDTEEGRLCGQRSSNNPHSPIVEEFQVPYNKLQVIFKSDFSNEERFTGFAAYYVATDINECTDFVD
VPCSHFCNNFIGGYFCSCPPEYFLHDDMKNCGVNCSGDVFTALIGEIASPNYPKPYPENSRCEYQIRLEK
GFQVVVTLRREDFDVEAADSAGNCLDSLVFVAGDRQFGPYCGHGFPGPLNIETKSNALDIIFQTDLTGQK
KGWKLRYHGDPMPCPKEDTPNSVWEPAKAKYVFRDVVQITCLDGFEVVEGRVGATSFYSTCQSNGKWSNS
KLKCQPVDCGIPESIENGKVEDPESTLFGSVIRYTCEEPYYYMENGGGGEYHCAGNGSWVNEVLGPELPK
CVPVCGVPREPFEEKQRIIGGSDADIKNFPWQVFFDNPWAGGALINEYWVLTAAHVVEGNREPTMYVGST
SVQTSRLAKSKMLTPEHVFIHPGWKLLEVPEGRTNFDNDIALVRLKDPVKMGPTVSPICLPGTSSDYNLM
DGDLGLISGWGRTEKRDRAVRLKAARLPVAPLRKCKEVKVEKPTADAEAYVFTPNMICAGGEKGMDSCKG
DSGGAFAVQDPNDKTKFYAAGLVSWGPQCGTYGLYTRVKNYVDWIMKTMQENSTPRED

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001725
RefSeq Size 2714
RefSeq ORF 2064
Synonyms EDSPD2
Locus ID 716
UniProt ID P09871
Cytogenetics 12p13.31
Summary This gene encodes a serine protease, which is a major constituent of the human complement subcomponent C1. C1s associates with two other complement components C1r and C1q in order to yield the first component of the serum complement system. Defects in this gene are the cause of selective C1s deficiency. provided by RefSeq, Mar 2009
Protein Families Druggable Genome, Protease
Protein Pathways Complement and coagulation cascades, Systemic lupus erythematosus
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "C1S" proteins (5)
SKU Description Size Price
LC400655 Lyophilized C1S HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC404424 Lyophilized C1S HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400655 Transient overexpression lysate of complement component 1, s subcomponent (C1S), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY404424 Transient overexpression lysate of complement component 1, s subcomponent (C1S), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP318963 Recombinant protein of human complement component 1, s subcomponent (C1S), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products