Ataxin 3 (ATXN3) (NM_004993) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC218923] |
Predicted MW | 41.1 kDa |
Protein Sequence |
Protein Sequence
>RC218923 representing NM_004993
Red=Cloning site Green=Tags(s) MESIFHEKQEGSLCAQHCLNNLLQGEYFSPVELSSIAHQLDEEERMRMAEGGVTSEDYRTFLQQPSGNMD DSGFFSIQVISNALKVWGLELILFNSPEYQRLRIDPINERSFICNYKEHWFTVRKLGKQWFNLNSLLTGP ELISDTYLALFLAQLQQEGYSIFVVKGDLPDCEADQLLQMIRVQQMHRPKLIGEELAQLKEQRVHKTDLE RVLEANDGSGMLDEDEEDLQRALALSRQEIDMEDEEADLRRAIQLSMQGSSRNISQDMTQTSGTNLTSEE LRKRREAYFEKQQQKQQQQQQQQQQGDLSGQSSHPCERPATSSGALGSDLGDAMSEEDMLQAAVTMSLET VRNDLKTEGKK myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_004984 |
RefSeq Size | 2698 |
RefSeq ORF | 1083 |
Synonyms | AT3; ATX3; JOS; MJD; MJD1; SCA3 |
Locus ID | 4287 |
UniProt ID | P54252 |
Cytogenetics | 14q32.12 |
Summary | Machado-Joseph disease, also known as spinocerebellar ataxia-3, is an autosomal dominant neurologic disorder. The protein encoded by this gene contains (CAG)n repeats in the coding region, and the expansion of these repeats from the normal 12-44 to 52-86 is one cause of Machado-Joseph disease. There is a negative correlation between the age of onset and CAG repeat numbers. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2016] |
Protein Families | Druggable Genome, Transcription Factors |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
LC410754 | ATXN3 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC417607 | ATXN3 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC426854 | ATXN3 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC431255 | ATXN3 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC432176 | ATXN3 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY410754 | Transient overexpression lysate of ataxin 3 (ATXN3), transcript variant h | 100 ug |
$436.00
|
|
LY417607 | Transient overexpression lysate of ataxin 3 (ATXN3), transcript variant reference | 100 ug |
$436.00
|
|
LY426854 | Transient overexpression lysate of ataxin 3 (ATXN3), transcript variant ad | 100 ug |
$436.00
|
|
LY431255 | Transient overexpression lysate of ataxin 3 (ATXN3), transcript variant y | 100 ug |
$436.00
|
|
LY432176 | Transient overexpression lysate of ataxin 3 (ATXN3), transcript variant e | 100 ug |
$436.00
|
|
TP318923 | Recombinant protein of human ataxin 3 (ATXN3), transcript variant 1, 20 µg | 20 ug |
$867.00
|
|
TP710359 | Purified recombinant protein of Human ataxin 3 (ATXN3), transcript variant reference, full length, with with C-terminal DDK tag, expressed in sf9, 20ug | 20 ug |
$515.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.