Ataxin 3 (ATXN3) (NM_004993) Human Mass Spec Standard

SKU
PH318923
ATXN3 MS Standard C13 and N15-labeled recombinant protein (NP_004984)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC218923]
Predicted MW 41.1 kDa
Protein Sequence
Protein Sequence
>RC218923 representing NM_004993
Red=Cloning site Green=Tags(s)

MESIFHEKQEGSLCAQHCLNNLLQGEYFSPVELSSIAHQLDEEERMRMAEGGVTSEDYRTFLQQPSGNMD
DSGFFSIQVISNALKVWGLELILFNSPEYQRLRIDPINERSFICNYKEHWFTVRKLGKQWFNLNSLLTGP
ELISDTYLALFLAQLQQEGYSIFVVKGDLPDCEADQLLQMIRVQQMHRPKLIGEELAQLKEQRVHKTDLE
RVLEANDGSGMLDEDEEDLQRALALSRQEIDMEDEEADLRRAIQLSMQGSSRNISQDMTQTSGTNLTSEE
LRKRREAYFEKQQQKQQQQQQQQQQGDLSGQSSHPCERPATSSGALGSDLGDAMSEEDMLQAAVTMSLET
VRNDLKTEGKK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004984
RefSeq Size 2698
RefSeq ORF 1083
Synonyms AT3; ATX3; JOS; MJD; MJD1; SCA3
Locus ID 4287
UniProt ID P54252
Cytogenetics 14q32.12
Summary Machado-Joseph disease, also known as spinocerebellar ataxia-3, is an autosomal dominant neurologic disorder. The protein encoded by this gene contains (CAG)n repeats in the coding region, and the expansion of these repeats from the normal 12-44 to 52-86 is one cause of Machado-Joseph disease. There is a negative correlation between the age of onset and CAG repeat numbers. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2016]
Protein Families Druggable Genome, Transcription Factors
Write Your Own Review
You're reviewing:Ataxin 3 (ATXN3) (NM_004993) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC410754 ATXN3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC417607 ATXN3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426854 ATXN3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431255 ATXN3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC432176 ATXN3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY410754 Transient overexpression lysate of ataxin 3 (ATXN3), transcript variant h 100 ug
$436.00
LY417607 Transient overexpression lysate of ataxin 3 (ATXN3), transcript variant reference 100 ug
$436.00
LY426854 Transient overexpression lysate of ataxin 3 (ATXN3), transcript variant ad 100 ug
$436.00
LY431255 Transient overexpression lysate of ataxin 3 (ATXN3), transcript variant y 100 ug
$436.00
LY432176 Transient overexpression lysate of ataxin 3 (ATXN3), transcript variant e 100 ug
$436.00
TP318923 Recombinant protein of human ataxin 3 (ATXN3), transcript variant 1, 20 µg 20 ug
$867.00
TP710359 Purified recombinant protein of Human ataxin 3 (ATXN3), transcript variant reference, full length, with with C-terminal DDK tag, expressed in sf9, 20ug 20 ug
$515.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.