PPM1L (NM_139245) Human Mass Spec Standard

SKU
PH318909
PPM1L MS Standard C13 and N15-labeled recombinant protein (NP_640338)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC218909]
Predicted MW 40.9 kDa
Protein Sequence
Protein Sequence
>RC218909 representing NM_139245
Red=Cloning site Green=Tags(s)

MIEDTMTLLSLLGRIMRYFLLRPETLFLLCISLALWSYFFHTDEVKTIVKSSRDAVKMVKGKVAEIMQND
RLGGLDVLEAEFSKTWEFKNHNVAVYSIQGRRDHMEDRFEVLTDLANKTHPSIFGIFDGHGGETAAEYVK
SRLPEALKQHLQDYEKDKENSVLSYQTILEQQILSIDREMLEKLTVSYDEAGTTCLIALLSDKDLTVANV
GDSRGVLCDKDGNAIPLSHDHKPYQLKERKRIKRAGGFISFNGSWRVQGILAMSRSLGDYPLKNLNVVIP
DPDILTFDLDKLQPEFMILASDGLWDAFSNEEAVRFIKERLDEPHFGAKSIVLQSFYRGCPDNITVMVVK
FRNSSKTEEQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_640338
RefSeq Size 3056
RefSeq ORF 1080
Synonyms PP2C-epsilon; PP2CE; PPM1-LIKE
Locus ID 151742
UniProt ID Q5SGD2
Cytogenetics 3q25.33-q26.1
Summary The protein encoded by this gene is a magnesium or manganese-requiring phosphatase that is involved in several signaling pathways. The encoded protein downregulates apoptosis signal-regulating kinase 1, a protein that initiates a signaling cascade that leads to apoptosis when cells are subjected to cytotoxic stresses. This protein also is an endoplasmic reticulum transmembrane protein that helps regulate ceramide transport from the endoplasmic reticulum to the Golgi apparatus. Finally, this gene may be involved in adiposity since it is upregulated in adipose tissues. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2015]
Protein Families Druggable Genome, Phosphatase
Write Your Own Review
You're reviewing:PPM1L (NM_139245) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC408320 PPM1L HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY408320 Transient overexpression lysate of protein phosphatase 1 (formerly 2C)-like (PPM1L) 100 ug
$436.00
TP318909 Recombinant protein of human protein phosphatase 1 (formerly 2C)-like (PPM1L), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.