HSPA14 (NM_016299) Human Mass Spec Standard

SKU
PH318858
HSPA14 MS Standard C13 and N15-labeled recombinant protein (NP_057383)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC218858]
Predicted MW 54.8 kDa
Protein Sequence
Protein Sequence
>RC218858 protein sequence
Red=Cloning site Green=Tags(s)

MAAIGVHLGCTSACVAVYKDGRAGVVANDAGDRVTPAVVAYSENEEIVGLAAKQSRIRNISNTVMKVKQI
LGRSSSDPQAQKYIAESKCLVIEKNGKLRYEIDTGEETKFVNPEDVARLIFSKMKETAHSVLGSDANDVV
ITVPFDFGEKQKNALGEAARAAGFNVLRLIHEPSAALLAYGIGQDSPTGKSNILVFKLGGTSLSLSVMEV
NSGIYRVLSTNTDDNIGGAHFTETLAQYLASEFQRSFKHDVRGNARAMMKLTNSAEVAKHSLSTLGSANC
FLDSLYEGQDFDCNVSRARFELLCSPLFNKCIEAIRGLLDQNGFTADDINKVVLCGGSSRIPKLQQLIKD
LFPAVELLNSIPPDEVIPIGAAIEAGILIGKENLLVEDSLMIECSARDILVKGVDESGASRFTVLFPSGT
PLPARRQHTLQAPGSISSVCLELYESDGKNSAKEETKFAQVVLQDLDKKENGLRDILAVLTMKRDGSLHV
TCTDQETGKCEAISIEIAS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057383
RefSeq Size 1921
RefSeq ORF 1527
Synonyms HSP70-4; HSP70L1
Locus ID 51182
UniProt ID Q0VDF9
Cytogenetics 10p13
Summary Component of the ribosome-associated complex (RAC), a complex involved in folding or maintaining nascent polypeptides in a folding-competent state. In the RAC complex, binds to the nascent polypeptide chain, while DNAJC2 stimulates its ATPase activity.[UniProtKB/Swiss-Prot Function]
Protein Families Druggable Genome, Stem cell - Pluripotency
Write Your Own Review
You're reviewing:HSPA14 (NM_016299) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC414070 HSPA14 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY414070 Transient overexpression lysate of heat shock 70kDa protein 14 (HSPA14), transcript variant 1 100 ug
$665.00
TP318858 Recombinant protein of human heat shock 70kDa protein 14 (HSPA14), transcript variant 1, 20 µg 20 ug
$737.00
TP761229 Purified recombinant protein of Human heat shock 70kDa protein 14 (HSPA14), transcript variant 1, full length, with N-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.