TFIIE alpha (GTF2E1) (NM_005513) Human Mass Spec Standard

SKU
PH318763
GTF2E1 MS Standard C13 and N15-labeled recombinant protein (NP_005504)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC218763]
Predicted MW 49.3 kDa
Protein Sequence
Protein Sequence
>RC218763 representing NM_005513
Red=Cloning site Green=Tags(s)

MADPDVLTEVPAALKRLAKYVIRGFYGIEHALALDILIRNSCVKEEDMLELLKFDRKQLRSVLNNLKGDK
FIKCRMRVETAADGKTTRHNYYFINYRTLVNVVKYKLDHMRRRIETDERDSTNRASFKCPVCSSTFTDLE
ANQLFDPMTGTFRCTFCHTEVEEDESAMPKKDARTLLARFNEQIEPIYALLRETEDVNLAYEILEPEPTE
IPALKQSKDHAATTAGAASLAGGHHREAWATKGPSYEDLYTQNVVINMDDQEDLHRASLEGKSAKERPIW
LRESTVQGAYGSEDMKEGGIDMDAFQEREEGHAGPDDNEEVMRALLIHEKKTSSAMAGSVGAAAPVTAAN
GDDSESETSESDDDSPPRPAAVAVHKREEDEEEDDEFEEVADDPIVMVAGRPFSYSEVSQRPELVAQMTP
EEKEAYIAMGQRMFEDLFE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005504
RefSeq Size 2969
RefSeq ORF 1317
Synonyms FE; TF2E1; TFIIE-A
Locus ID 2960
UniProt ID P29083
Cytogenetics 3q13.33
Summary Recruits TFIIH to the initiation complex and stimulates the RNA polymerase II C-terminal domain kinase and DNA-dependent ATPase activities of TFIIH. Both TFIIH and TFIIE are required for promoter clearance by RNA polymerase.[UniProtKB/Swiss-Prot Function]
Protein Families Transcription Factors
Protein Pathways Basal transcription factors
Write Your Own Review
You're reviewing:TFIIE alpha (GTF2E1) (NM_005513) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC417254 GTF2E1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY417254 Transient overexpression lysate of general transcription factor IIE, polypeptide 1, alpha 56kDa (GTF2E1) 100 ug
$665.00
TP318763 Recombinant protein of human general transcription factor IIE, polypeptide 1, alpha 56kDa (GTF2E1), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.