HDAC10 (NM_032019) Human Mass Spec Standard

SKU
PH318536
HDAC10 MS Standard C13 and N15-labeled recombinant protein (NP_114408)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC218536]
Predicted MW 71.3 kDa
Protein Sequence
Protein Sequence
>RC218536 representing NM_032019
Red=Cloning site Green=Tags(s)

MGTALVYHEDMTATRLLWDDPECEIERPERLTAALDRLRQRGLEQRCLRLSAREASEEELGLVHSPEYVS
LVRETQVLGKEELQALSGQFDAIYFHPSTFHCARLAAGAGLQLVDAVLTGAVQNGLALVRPPGHHGQRAA
ANGFCVFNNVAIAAAHAKQKHGLHRILVVDWDVHHGQGIQYLFEDDPSVLYFSWHRYEHGRFWPFLRESD
ADAVGRGQGLGFTVNLPWNQVGMGNADYVAAFLHLLLPLAFEFDPELVLVSAGFDSAIGDPEGQMQATPE
CFAHLTQLLQVLAGGRVCAVLEGGYHLESLAESVCMTVQTLLGDPAPPLSGPMAPCQSALESIQSARAAQ
APHWKSLQQQDVTAVPMSPSSHSPEGRPPPLLPGGPVCKAAASAPSSLLDQPCLCPAPSVRTAVALTTPD
ITLVLPPDVIQQEASALREETEAWARPHESLAREEALTALGKLLYLLDGMLDGQVNSGIAATPASAAAAT
LDVAVRRGLSHGAQRLLCVALGQLDRPPDLAHDGRSLWLNIRGKEAAALSMFHVSTPLPVMTGGFLSCIL
GLVLPLAYGFQPDLVLVALGPGHGLQGPHAALLAAMLRGLAGGRVLALLEENSTPQLAGILARVLNGEAP
PSLGPSSVASPEDVQALMYLRGQLEPQWKMLQCHPHLVA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_114408
RefSeq Size 2702
RefSeq ORF 2007
Synonyms HD10
Locus ID 83933
UniProt ID Q969S8
Cytogenetics 22q13.33
Summary The protein encoded by this gene belongs to the histone deacetylase family, members of which deacetylate lysine residues on the N-terminal part of the core histones. Histone deacetylation modulates chromatin structure, and plays an important role in transcriptional regulation, cell cycle progression, and developmental events. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2011]
Protein Families Druggable Genome, Transcription Factors
Write Your Own Review
You're reviewing:HDAC10 (NM_032019) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC403142 HDAC10 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC431546 HDAC10 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403142 Transient overexpression lysate of histone deacetylase 10 (HDAC10), transcript variant 1 100 ug
$665.00
LY431546 Transient overexpression lysate of histone deacetylase 10 (HDAC10), transcript variant 2 100 ug
$436.00
TP318536 Recombinant protein of human histone deacetylase 10 (HDAC10), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.