FAM61B (LSM14B) (NM_144703) Human Mass Spec Standard

SKU
PH318487
LSM14B MS Standard C13 and N15-labeled recombinant protein (NP_653304)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC218487]
Predicted MW 41.9 kDa
Protein Sequence
Protein Sequence
>RC218487 representing NM_144703
Red=Cloning site Green=Tags(s)

MSGSSGTPYLGSKISLISKAQIRYEGILYTIDTDNSTVALAKVRSFGTEDRPTDRPAPPREEIYEYIIFR
GSDIKDITVCEPPKAQHTLPQDPAIVQSSLGSASASPFQPHVPYSPFRGMAPYGPLAASSLLSQQYAASL
GLGAGFPSIPVGKSPMVEQAVQTGSADNLNAKKLLPGKGTTGTQLNGRQAQPSSKTASDVVQPAAVQAQG
QVNDENRRPQRRRSGNRRTRNRSRGQNRPTNVKENTIKFEGDFDFESANAQFNREELDKEFKKKLNFKDD
KAEKGEEKDLAVVTQSAEAPAEEDLLGPNCYYDKSKSFFDNISSELKTSSRRTTWAEERKLNTETFGVSG
RFLRGRSSRGGFRGGRGNGTTRRNPTSHRAGTGRV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_653304
RefSeq Size 2618
RefSeq ORF 1155
Synonyms bA11M20.3; C20orf40; FAM61B; FT005; LSM13; RAP55B
Locus ID 149986
UniProt ID Q9BX40
Cytogenetics 20q13.33
Summary May play a role in control of mRNA translation.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:FAM61B (LSM14B) (NM_144703) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC408171 LSM14B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY408171 Transient overexpression lysate of LSM14B, SCD6 homolog B (S. cerevisiae) (LSM14B) 100 ug
$436.00
TP318487 Recombinant protein of human LSM14B, SCD6 homolog B (S. cerevisiae) (LSM14B), 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.