OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Monoacylglycerol Lipase (MGLL) (NM_007283) Human Mass Spec Standard

Be the first to review this product
SKU
PH318358
MGLL MS Standard C13 and N15-labeled recombinant protein (NP_009214)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA502932 MGLL (Monoacylglycerol Lipase) mouse monoclonal antibody, clone OTI1H1 (formerly 1H1)
100 ul
$447.00
LY402124 Transient overexpression lysate of monoglyceride lipase (MGLL), transcript variant 1 (as WB positive control)
100 ug
$436.00

Other products for "Monoacylglycerol Lipase or NM_007283"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC218358
Predicted MW 34.1 kDa
Protein Sequence
Protein Sequence
>RC218358 representing NM_007283
Red=Cloning site Green=Tags(s)

METGPEDPSSMPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEE
LARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAIL
TAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLI
CRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHV
LHKELPEVTNSVFHEINMWVSQRTATAGTASPP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_009214
RefSeq Size 4617
RefSeq ORF 939
Synonyms HU-K5; HUK5; MAGL; MGL
Locus ID 11343
UniProt ID Q99685
Cytogenetics 3q21.3
Summary This gene encodes a serine hydrolase of the AB hydrolase superfamily that catalyzes the conversion of monoacylglycerides to free fatty acids and glycerol. The encoded protein plays a critical role in several physiological processes including pain and nociperception through hydrolysis of the endocannabinoid 2-arachidonoylglycerol. Expression of this gene may play a role in cancer tumorigenesis and metastasis. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. provided by RefSeq, Feb 2012
Protein Families Druggable Genome, Protease
Protein Pathways Glycerolipid metabolism, Metabolic pathways
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Monoacylglycerol Lipase" proteins (3)
SKU Description Size Price
LC402124 Lyophilized MGLL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402124 Transient overexpression lysate of monoglyceride lipase (MGLL), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP318358 Recombinant protein of human monoglyceride lipase (MGLL), transcript variant 1, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products