Monoacylglycerol Lipase (MGLL) (NM_007283) Human Mass Spec Standard

SKU PH318358

MGLL MS Standard C13 and N15-labeled recombinant protein (NP_009214)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC218358]
• Predicted MW: 34.1 kDa
• Protein Sequence:
  Protein Sequence

  >RC218358 representing NM_007283; Red=Cloning site Green=Tags(s); ; METGPEDPSSMPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEE; LARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAIL; TAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLI; CRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHV; LHKELPEVTNSVFHEINMWVSQRTATAGTASPP; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_009214
• RefSeq Size: 4617
• RefSeq ORF: 939
• Synonyms: HU-K5; HUK5; MAGL; MGL
• Locus ID: 11343
• UniProt ID: Q99685
• Cytogenetics: 3q21.3
• Summary: This gene encodes a serine hydrolase of the AB hydrolase superfamily that catalyzes the conversion of monoacylglycerides to free fatty acids and glycerol. The encoded protein plays a critical role in several physiological processes including pain and nociperception through hydrolysis of the endocannabinoid 2-arachidonoylglycerol. Expression of this gene may play a role in cancer tumorigenesis and metastasis. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Feb 2012]
• Protein Families: Druggable Genome, Protease
• Protein Pathways: Glycerolipid metabolism, Metabolic pathways