RGP1 (NM_001080496) Human Mass Spec Standard

SKU
PH318325
RGP1 MS Standard C13 and N15-labeled recombinant protein (NP_001073965)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC218325]
Predicted MW 42.46 kDa
Protein Sequence
Protein Sequence
>RC218325 representing NM_001080496
Red=Cloning site Green=Tags(s)

MIEVVAELSRGPVFLAGEALECVVTVTNPLPPTATSASSEALAWASAQIHCQFHASESRVALPPPDSSQP
DVQPDSQTVFLPHRGERGQCILSTPPKILFCDLRLDPGESKSYSYSEVLPIEGPPSFRGQSVKYVYKLTI
GCQRVNSPITLLRVPLRVLVLTGLQDVRFPQDEAVAPSSPFLEEDEGGKKDSWLAELAGERLMAATSCRS
LHLYNISDGRGKVGTFGIFKSVYRLGEDVVGTLNLGEGTVACLQFSVSLQTEERVQPEYQRRRGAGGVPS
VSHVTHARHQESCLHTTRTSFSLPIPLSSTPGFCTAIVSLKWRLHFEFVTSREPGLVLLPPVEQPEPTTW
TGPEQVPVDTFSWDLPIKVLPTSPTLASYAAPGPSTSTITI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001073965
RefSeq Size 1296
RefSeq ORF 1173
Synonyms KIAA0258
Locus ID 9827
UniProt ID Q92546
Cytogenetics 9p13.3
Summary The RIC1-RGP1 complex acts as a guanine nucleotide exchange factor (GEF), which activates RAB6A by exchanging bound GDP for free GTP and may thereby required for efficient fusion of endosome-derived vesicles with the Golgi compartment. The RIC1-RGP1 complex participates in the recycling of mannose-6-phosphate receptors.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:RGP1 (NM_001080496) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC421051 RGP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY421051 Transient overexpression lysate of RGP1 retrograde golgi transport homolog (S. cerevisiae) (RGP1) 100 ug
$665.00
TP318325 Recombinant protein of human RGP1 retrograde golgi transport homolog (S. cerevisiae) (RGP1), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.