DUSP13 (NM_001007272) Human Mass Spec Standard

SKU
PH318322
DUSP13 MS Standard C13 and N15-labeled recombinant protein (NP_001007273)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC218322]
Predicted MW 27.3 kDa
Protein Sequence
Protein Sequence
>RC218322 representing NM_001007272
Red=Cloning site Green=Tags(s)

MAETSLPELGGEDKATPCPSILELEELLRAGKSSCSRVDEVWPNLFIGDAMDSLQKQDLRRPKIHGAVQA
SPYQPPTLASLQRLLWVRQAATLNHIDEVWPSLFLGDAYAARDKSKLIQLGITHVVNAAAGKFQVDTGAK
FYRGMSLEYYGIEADDNPFFDLSVYFLPVARYIRAALSVPQGRVLVHCAMGVSRSATLVLAFLMICENMT
LVEAIQTVQAHRNICPNSGFLRQLQVLDNRLGRETGRF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001007273
RefSeq Size 1063
RefSeq ORF 744
Synonyms BEDP; DUSP13A; DUSP13B; MDSP; SKRP4; TMDP
Locus ID 51207
UniProt ID Q6B8I1
Cytogenetics 10q22.2
Summary Members of the protein-tyrosine phosphatase superfamily cooperate with protein kinases to regulate cell proliferation and differentiation. This superfamily is separated into two families based on the substrate that is dephosphorylated. One family, the dual specificity phosphatases (DSPs) acts on both phosphotyrosine and phosphoserine/threonine residues. This gene encodes different but related DSP proteins through the use of non-overlapping open reading frames, alternate splicing, and presumed different transcription promoters. Expression of the distinct proteins from this gene has been found to be tissue specific and the proteins may be involved in postnatal development of specific tissues. A protein encoded by the upstream ORF was found in skeletal muscle, whereas the encoded protein from the downstream ORF was found only in testis. In mouse, a similar pattern of expression was found. Multiple alternatively spliced transcript variants were described, but the full-length sequence of only some were determined. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Phosphatase
Write Your Own Review
You're reviewing:DUSP13 (NM_001007272) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH303085 DUSP13 MS Standard C13 and N15-labeled recombinant protein (NP_057448) 10 ug
$3,255.00
LC413984 DUSP13 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC423481 DUSP13 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC423482 DUSP13 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY413984 Transient overexpression lysate of dual specificity phosphatase 13 (DUSP13), transcript variant 6 100 ug
$436.00
LY423481 Transient overexpression lysate of dual specificity phosphatase 13 (DUSP13), transcript variant 2 100 ug
$436.00
LY423482 Transient overexpression lysate of dual specificity phosphatase 13 (DUSP13), transcript variant 3 100 ug
$436.00
TP303085 Recombinant protein of human dual specificity phosphatase 13 (DUSP13), transcript variant 6, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP318322 Recombinant protein of human dual specificity phosphatase 13 (DUSP13), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.