OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

USP1 (NM_001017416) Human Mass Spec Standard

Be the first to review this product
SKU
PH318309
USP1 MS Standard C13 and N15-labeled recombinant protein (NP_001017416)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY418724 Transient overexpression lysate of ubiquitin specific peptidase 1 (USP1), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "USP1 or NM_001017416"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC218309
Predicted MW 88 kDa
Protein Sequence
Protein Sequence
>RC218309 representing NM_001017416
Red=Cloning site Green=Tags(s)

MPGVIPSESNGLSRGSPSKKNRLSLKFFQKKETKRALDFTDSQENEEKASEYRASEIDQVVPAAQSSPIN
CEKRENLLPFVGLNNLGNTCYLNSILQVLYFCPGFKSGVKHLFNIISRKKEALKDEANQKDKGNCKEDSL
ASYELICSLQSLIISVEQLQASFLLNPEKYTDELATQPRRLLNTLRELNPMYEGYLQHDAQEVLQCILGN
IQETCQLLKKEEVKNVAELPTKVEEIPHPKEEMNGINSIEMDSMRHSEDFKEKLPKGNGKRKSDTEFGNM
KKKVKLSKEHQSLEENQRQTRSKRKATSDTLESPPKIIPKYISENESPRPSQKKSRVKINWLKSATKQPS
ILSKFCSLGKITTNQGVKGQSKENECDPEEDLGKCESDNTTNGCGLESPGNTVTPVNVNEVKPINKGEEQ
IGFELVEKLFQGQLVLRTRCLECESLTERREDFQDISVPVQEDELSKVEESSEISPEPKTEMKTLRWAIS
QFASVERIVGEDKYFCENCHHYTEAERSLLFDKMPEVITIHLKCFAASGLEFDCYGGGLSKINTPLLTPL
KLSLEEWSTKPTNDSYGLFAVVMHSGITISSGHYTASVKVTDLNSLELDKGNFVVDQMCEIGKPEPLNEE
EARGVVENYNDEEVSIRVGGNTQPSKVLNKKNVEAIGLLGGQKSKADYELYNKASNPDKVASTAFAENRN
SETSDTTGTHESDRNKESSDQTGINISGFENKISYVVQSLKEYEGKWLLFDDSEVKVTEEKDFLNSLSPS
TSPTSTPYLLFYKKL

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001017416
RefSeq Size 3424
RefSeq ORF 2355
Synonyms UBP
Locus ID 7398
UniProt ID O94782
Cytogenetics 1p31.3
Summary This gene encodes a member of the ubiquitin-specific processing (UBP) family of proteases that is a deubiquitinating enzyme (DUB) with His and Cys domains. This protein is located in the cytoplasm and cleaves the ubiquitin moiety from ubiquitin-fused precursors and ubiquitinylated proteins. The protein specifically deubiquitinates a protein in the Fanconi anemia (FA) DNA repair pathway. Alternate transcriptional splice variants have been characterized. provided by RefSeq, Jul 2008
Protein Families Protease
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "USP1" proteins (7)
SKU Description Size Price
LC418724 Lyophilized USP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422784 Lyophilized USP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422785 Lyophilized USP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418724 Transient overexpression lysate of ubiquitin specific peptidase 1 (USP1), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY422784 Transient overexpression lysate of ubiquitin specific peptidase 1 (USP1), transcript variant 2 (as WB positive control) 100 ug
$665.00
LY422785 Transient overexpression lysate of ubiquitin specific peptidase 1 (USP1), transcript variant 3 (as WB positive control) 100 ug
$665.00
TP318309 Recombinant protein of human ubiquitin specific peptidase 1 (USP1), transcript variant 3, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products