USP1 (NM_001017416) Human Mass Spec Standard

SKU
PH318309
USP1 MS Standard C13 and N15-labeled recombinant protein (NP_001017416)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC218309]
Predicted MW 88 kDa
Protein Sequence
Protein Sequence
>RC218309 representing NM_001017416
Red=Cloning site Green=Tags(s)

MPGVIPSESNGLSRGSPSKKNRLSLKFFQKKETKRALDFTDSQENEEKASEYRASEIDQVVPAAQSSPIN
CEKRENLLPFVGLNNLGNTCYLNSILQVLYFCPGFKSGVKHLFNIISRKKEALKDEANQKDKGNCKEDSL
ASYELICSLQSLIISVEQLQASFLLNPEKYTDELATQPRRLLNTLRELNPMYEGYLQHDAQEVLQCILGN
IQETCQLLKKEEVKNVAELPTKVEEIPHPKEEMNGINSIEMDSMRHSEDFKEKLPKGNGKRKSDTEFGNM
KKKVKLSKEHQSLEENQRQTRSKRKATSDTLESPPKIIPKYISENESPRPSQKKSRVKINWLKSATKQPS
ILSKFCSLGKITTNQGVKGQSKENECDPEEDLGKCESDNTTNGCGLESPGNTVTPVNVNEVKPINKGEEQ
IGFELVEKLFQGQLVLRTRCLECESLTERREDFQDISVPVQEDELSKVEESSEISPEPKTEMKTLRWAIS
QFASVERIVGEDKYFCENCHHYTEAERSLLFDKMPEVITIHLKCFAASGLEFDCYGGGLSKINTPLLTPL
KLSLEEWSTKPTNDSYGLFAVVMHSGITISSGHYTASVKVTDLNSLELDKGNFVVDQMCEIGKPEPLNEE
EARGVVENYNDEEVSIRVGGNTQPSKVLNKKNVEAIGLLGGQKSKADYELYNKASNPDKVASTAFAENRN
SETSDTTGTHESDRNKESSDQTGINISGFENKISYVVQSLKEYEGKWLLFDDSEVKVTEEKDFLNSLSPS
TSPTSTPYLLFYKKL

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001017416
RefSeq Size 3424
RefSeq ORF 2355
Synonyms UBP
Locus ID 7398
UniProt ID O94782
Cytogenetics 1p31.3
Summary This gene encodes a member of the ubiquitin-specific processing (UBP) family of proteases that is a deubiquitinating enzyme (DUB) with His and Cys domains. This protein is located in the cytoplasm and cleaves the ubiquitin moiety from ubiquitin-fused precursors and ubiquitinylated proteins. The protein specifically deubiquitinates a protein in the Fanconi anemia (FA) DNA repair pathway. Alternate transcriptional splice variants have been characterized. [provided by RefSeq, Jul 2008]
Protein Families Protease
Write Your Own Review
You're reviewing:USP1 (NM_001017416) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC418724 USP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422784 USP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422785 USP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418724 Transient overexpression lysate of ubiquitin specific peptidase 1 (USP1), transcript variant 1 100 ug
$436.00
LY422784 Transient overexpression lysate of ubiquitin specific peptidase 1 (USP1), transcript variant 2 100 ug
$665.00
LY422785 Transient overexpression lysate of ubiquitin specific peptidase 1 (USP1), transcript variant 3 100 ug
$665.00
TP318309 Recombinant protein of human ubiquitin specific peptidase 1 (USP1), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.