CCDC16 (ZNF830) (NM_052857) Human Mass Spec Standard

SKU
PH318305
ZNF830 MS Standard C13 and N15-labeled recombinant protein (NP_443089)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC218305]
Predicted MW 41.8 kDa
Protein Sequence
Protein Sequence
>RC218305 representing NM_052857
Red=Cloning site Green=Tags(s)

MASSASARTPAGKRVINQEELRRLMKEKQRLSTSRKRIESPFAKYNRLGQLSCALCNTPVKSELLWQTHV
LGKQHREKVAELKGAKEASQGSSASSAPHSVKRKAPDADDQDVKRAKATLVPQVQPSTSAWTTNFDKIGK
EFIRATPSKPSGLSLLPDYEDEEEEEEEEEGDGERKRGDASKPLSDAQGKEHSVSSSREVTSSVLPNDFF
STNPPKAPIIPHSGSIEKAEIHEKVVERRENTAEALPEGFFDDPEVDARVRKVDAPKDQMDKEWDEFQKA
MRQVNTISEAIVAEEDEEGRLDRQIGEIDEQIECYRRVEKLRNRQDEIKNKLKEILTIKELQKKEEENAD
SDDEGELQDLLSQDWRVKGALL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_443089
RefSeq Size 1646
RefSeq ORF 1116
Synonyms CCDC16; OMCG1
Locus ID 91603
UniProt ID Q96NB3
Cytogenetics 17q12
Summary May play a role in pre-mRNA splicing as component of the spliceosome (PubMed:25599396). Acts as an important regulator of the cell cycle that participates in the maintenance of genome integrity. During cell cycle progression in embryonic fibroblast, prevents replication fork collapse, double-strand break formation and cell cycle checkpoint activation. Controls mitotic cell cycle progression and cell survival in rapidly proliferating intestinal epithelium and embryonic stem cells. During the embryo preimplantation, controls different aspects of M phase. During early oocyte growth, plays a role in oocyte survival by preventing chromosomal breaks formation, activation of TP63 and reduction of transcription (By similarity).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:CCDC16 (ZNF830) (NM_052857) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC409433 ZNF830 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY409433 Transient overexpression lysate of zinc finger protein 830 (ZNF830) 100 ug
$436.00
TP318305 Recombinant protein of human zinc finger protein 830 (ZNF830), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.