C14orf130 (UBR7) (NM_175748) Human Mass Spec Standard

SKU
PH318298
UBR7 MS Standard C13 and N15-labeled recombinant protein (NP_786924)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC218298]
Predicted MW 47.8 kDa
Protein Sequence
Protein Sequence
>RC218298 representing NM_175748
Red=Cloning site Green=Tags(s)

MAGAEGAAGRQSELEPVVSLVDVLEEDEELENEACAVLGGSDSEKCSYSQGSVKRQALYACSTCTPEGEE
PAGICLACSYECHGSHKLFELYTKRNFRCDCGNSKFKNLECKLLPDKAKVNSGNKYNDNFFGLYCICKRP
YPDPEDEIPDEMIQCVVCEDWFHGRHLGAIPPESGDFQEMVCQACMKRCSFLWAYAAQLAVTKISTEDDG
LVRNIDGIGDQEVIKPENGEHQDSTLKEDVPEQGKDDVREVKVEQNSEPCAGSSSESDLQTVFKNESLNA
ESKSGCKLQELKAKQLIKKDTATYWPLNWRSKLCTCQDCMKMYGDLDVLFLTDEYDTVLAYENKGKIAQA
TDRSDPLMDTLSSMNRVQQVELICEYNDLKTELKDYLKRFADEGTVVKREDIQQFFEEFQSKKRRRVDGM
QYYCS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_786924
RefSeq Size 1576
RefSeq ORF 1275
Synonyms C14orf130; LICAS
Locus ID 55148
UniProt ID Q8N806
Cytogenetics 14q32.12
Summary This gene encodes a UBR box-containing protein that belongs to the E3 ubiquitin ligase family. The protein also contains a plant homeodomain (PHD) in the C-terminus. In mammals, the encoded protein recognizes N-degrons, the destabilizing N-terminal residues of short-lived proteins, which results in ubiquitinylation, and proteolysis via the proteasome. [provided by RefSeq, Jul 2016]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:C14orf130 (UBR7) (NM_175748) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC403580 UBR7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC420256 UBR7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403580 Transient overexpression lysate of ubiquitin protein ligase E3 component n-recognin 7 (putative) (UBR7), transcript variant 2 100 ug
$436.00
LY420256 Transient overexpression lysate of ubiquitin protein ligase E3 component n-recognin 7 (putative) (UBR7), transcript variant 3 100 ug
$436.00
TP318298 Recombinant protein of human ubiquitin protein ligase E3 component n-recognin 7 (putative) (UBR7), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.