CD229 (LY9) (NM_002348) Human Mass Spec Standard

SKU
PH318201
LY9 MS Standard C13 and N15-labeled recombinant protein (NP_002339)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC218201]
Predicted MW 72 kDa
Protein Sequence
Protein Sequence
>RC218201 representing NM_002348
Red=Cloning site Green=Tags(s)

MVAPKSHTDDWAPGPFSSKPQRSQLQIFSSVLQTSLLFLLMGLRASGKDSAPTVVSGILGGSVTLPLNIS
VDTEIENVIWIGPKNALAFARPKENVTIMVKSYLGRLDITKWSYSLCISNLTLNDAGSYKAQINQRNFEV
TTEEEFTLFVYEQLQEPQVTMKSVKVSENFSCNITLMCSVKGAEKSVLYSWTPREPHASESNGGSILTVS
RTPCDPDLPYICTAQNPVSQRSSLPVHVGQFCTDPGASRGGTTGETVVGVLGEPVTLPLALPACRDTEKV
VWLFNTSIISKEREEAATADPLIKSRDPYKNRVWVSSQDCSLKISQLKIEDAGPYHAYVCSEASSVTSMT
HVTLLIYRRLRKPKITWSLRHSEDGICRISLTCSVEDGGNTVMYTWTPLQKEAVVSQGESHLNVSWRSSE
NHPNLTCTASNPVSRSSHQFLSENICSGPERNTKLWIGLFLMVCLLCVGIFSWCIWKRKGRCSVPAFCSS
QAEAPADTPEPTAGHTLYSVLSQGYEKLDTPLRPARQQPTPTSDSSSDSNLTTEEDEDRPEVHKPISGRY
EVFDQVTQEGAGHDPAPEGQADYDPVTPYVTEVESVVGENTMYAQVFNLQGKTPVSQKEESSATIYCSIR
KPQVVPPPQQNDLEIPESPTYENFT

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002339
RefSeq Size 2486
RefSeq ORF 1965
Synonyms CD229; hly9; mLY9; SLAMF3
Locus ID 4063
UniProt ID Q9HBG7
Cytogenetics 1q23.3
Summary LY9 belongs to the SLAM family of immunomodulatory receptors (see SLAMF1; MIM 603492) and interacts with the adaptor molecule SAP (SH2D1A; MIM 300490) (Graham et al., 2006 [PubMed 16365421]).[supplied by OMIM, Mar 2008]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:CD229 (LY9) (NM_002348) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC419384 LY9 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY419384 Transient overexpression lysate of lymphocyte antigen 9 (LY9), transcript variant 1 100 ug
$665.00
TP318201 Recombinant protein of human lymphocyte antigen 9 (LY9), transcript variant 1, 20 µg 20 ug
$737.00
TP710238 Purified recombinant protein of Human lymphocyte antigen 9 (LY9), transcript variant 1, residues 48-454aa, secretory expressed with GP67 signal peptide, with C-terminal DDK tag, expressed in sf9 insect cells 20 ug
$515.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.