MLIP (NM_138569) Human Mass Spec Standard

SKU
PH318122
C6orf142 MS Standard C13 and N15-labeled recombinant protein (NP_612636)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC218122]
Predicted MW 50.2 kDa
Protein Sequence
Protein Sequence
>RC218122 representing NM_138569
Red=Cloning site Green=Tags(s)

MELEKREKRSLLNKNLEEKLTVSAGGSEAKPLIFTFVPTVRRLPTHTQLADTSKFLVKIPEESSDKSPET
VNRSKSNDYLTLNAGSQQERDQAKLTCPSEVSGTILQEREFEANKLQGMQQSDLFKAEYVLIVDSEGEDE
AASRKVEQGPPGGIGTAAVRPKSLAISSSLVSDVVRPKTQGTDLKTSSHPEMLHGMAPQQKHGQQYKTKS
SYKAFAAIPTNTLLLEQKALDEPAKTESVSKDNTLEPPVELYFPAQLRQQTEELCATIDKVLQDSLSMHS
SDSPSRSPKTLLGSDTVKTPTTLPRAAGRETKYANLSSPSSTVSESQLTKPGVIRPVPVKSRILLKKEEE
VYEPNPFSKYLEDNSDLFSEQDVTVPPKPVSLHPLYQTKLYPPAKSLLHPQTLSHADCLAPGPFSHLSFS
LSDEQENSHTLLSHNACNKLSHPMVAIPEHEALDSKEQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_612636
RefSeq Size 1740
RefSeq ORF 1374
Synonyms C6orf142; CIP
Locus ID 90523
UniProt ID Q5VWP3
Cytogenetics 6p12.1
Summary Required for precocious cardiac adaptation to stress through integrated regulation of the AKT/mTOR pathways and FOXO1. Regulates cardiac homeostasis and plays an important role in protection against cardiac hypertrophy. Acts as a transcriptional cofactor, represses transactivator activity of ISL1 and MYOCD.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:MLIP (NM_138569) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC408572 MLIP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY408572 Transient overexpression lysate of chromosome 6 open reading frame 142 (C6orf142) 100 ug
$665.00
TP318122 Recombinant protein of human chromosome 6 open reading frame 142 (C6orf142), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.