TCEAL3 (NM_032926) Human Mass Spec Standard

SKU
PH318119
TCEAL3 MS Standard C13 and N15-labeled recombinant protein (NP_116315)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC218119]
Predicted MW 22.5 kDa
Protein Sequence
Protein Sequence
>RC218119 protein sequence
Red=Cloning site Green=Tags(s)

MEKPYNKNEGNLENEGKPEDEVEPDDEGKSDEEEKPDVEGKTECEGKREDEGEPGDEGQLEDEGSQEKQG
RSEGEGKPQGEGKPASQAKPESQPRAAEKRPAEDYVPRKAKRKTDRGTDDSPKDSQEDLQERHLSSEEMM
RECGDVSRAQEELRKKQKMGGFHWMQRDVQDPFAPRGQRGVRGVRGGGRGQRGLHDIPYL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_116315
RefSeq Size 1142
RefSeq ORF 600
Synonyms WEX8
Locus ID 85012
UniProt ID Q969E4
Cytogenetics Xq22.2
Summary This gene encodes a member of the transcription elongation factor A (SII)-like (TCEAL) gene family. Members of this family contain TFA domains and may function as nuclear phosphoproteins that modulate transcription in a promoter context-dependent manner. Multiple family members are located on the X chromosome. Alternative splicing results in multiple transcript variants encoding a single isoform. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:TCEAL3 (NM_032926) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH303524 TCEAL3 MS Standard C13 and N15-labeled recombinant protein (NP_001006934) 10 ug
$3,255.00
LC409871 TCEAL3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC423552 TCEAL3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY409871 Transient overexpression lysate of transcription elongation factor A (SII)-like 3 (TCEAL3), transcript variant 2 100 ug
$436.00
LY423552 Transient overexpression lysate of transcription elongation factor A (SII)-like 3 (TCEAL3), transcript variant 1 100 ug
$436.00
TP303524 Recombinant protein of human transcription elongation factor A (SII)-like 3 (TCEAL3), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP318119 Recombinant protein of human transcription elongation factor A (SII)-like 3 (TCEAL3), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.