LBX1 (NM_006562) Human Mass Spec Standard

SKU
PH318048
LBX1 MS Standard C13 and N15-labeled recombinant protein (NP_006553)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC218048]
Predicted MW 30 kDa
Protein Sequence
Protein Sequence
>RC218048 representing NM_006562
Red=Cloning site Green=Tags(s)

MTSKEDGKAAPGEERRRSPLDHLPPPANSNKPLTPFSIEDILNKPSVRRSYSLCGAAHLLAAADKHAQGG
LPLAGRALLSQTSPLCALEELASKTFKGLEVSVLQAAEGRDGMTIFGQRQTPKKRRKSRTAFTNHQIYEL
EKRFLYQKYLSPADRDQIAQQLGLTNAQVITWFQNRRAKLKRDLEEMKADVESAKKLGPSGQMDIVALAE
LEQNSEATAGGGGGCGRAKSRPGSPVLPPGAPKAPGAGALQLSPASPLTDQPASSQDCSEDEEDEEIDVD
D

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006553
RefSeq Size 1287
RefSeq ORF 843
Synonyms homeobox; HPX-6; HPX6; LBX1H
Locus ID 10660
UniProt ID P52954
Cytogenetics 10q24.32
Summary This gene and the orthologous mouse gene were found by their homology to the Drosophila lady bird early and late homeobox genes. In the mouse, this gene is a key regulator of muscle precursor cell migration and is required for the acquisition of dorsal identities of forelimb muscles. [provided by RefSeq, Jul 2008]
Protein Families Transcription Factors
Write Your Own Review
You're reviewing:LBX1 (NM_006562) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC416561 LBX1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY416561 Transient overexpression lysate of ladybird homeobox 1 (LBX1) 100 ug
$436.00
TP318048 Recombinant protein of human ladybird homeobox 1 (LBX1), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.