TRIM72 (NM_001008274) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC218023] |
Predicted MW | 52.6 kDa |
Protein Sequence |
Protein Sequence
>RC218023 representing NM_001008274
Red=Cloning site Green=Tags(s) MSAAPGLLHQELSCPLCLQLFDAPVTAECGHSFCRACLGRVAGEPAADGTVLCPCCQAPTRPQALSTNLQ LARLVEGLAQVPQGHCEEHLDPLSIYCEQDRALVCGVCASLGSHRGHRLLPAAEAHARLKTQLPQQKLQL QEACMRKEKSVAVLEHQLVEVEETVRQFRGAVGEQLGKMRVFLAALEGSLDREAERVRGEAGVALRRELG SLNSYLEQLRQMEKVLEEVADKPQTEFLMKYCLVTSRLQKILAESPPPARLDIQLPIISDDFKFQVWRKM FRALMPALEELTFDPSSAHPSLVVSSSGRRVECSEQKAPPAGEDPRQFDKAVAVVAHQQLSEGEHYWEVD VGDKPRWALGVIAAEAPRRGRLHAVPSQGLWLLGLREGKILEAHVEAKEPRALRSPERRPTRIGLYLSFG DGVLSFYDASDADALVPLFAFHERLPRPVYPFFDVCWHDKGKNAQPLLLVGPEGAEA myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001008275 |
RefSeq Size | 2098 |
RefSeq ORF | 1431 |
Synonyms | MG53 |
Locus ID | 493829 |
UniProt ID | Q6ZMU5 |
Cytogenetics | 16p11.2 |
Summary | Muscle-specific protein that plays a central role in cell membrane repair by nucleating the assembly of the repair machinery at injury sites. Specifically binds phosphatidylserine. Acts as a sensor of oxidation: upon membrane damage, entry of extracellular oxidative environment results in disulfide bond formation and homooligomerization at the injury site. This oligomerization acts as a nucleation site for recruitment of TRIM72-containing vesicles to the injury site, leading to membrane patch formation. Probably acts upstream of the Ca(2+)-dependent membrane resealing process. Required for transport of DYSF to sites of cell injury during repair patch formation. Regulates membrane budding and exocytosis. May be involved in the regulation of the mobility of KCNB1-containing endocytic vesicles (By similarity).[UniProtKB/Swiss-Prot Function] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
LC423413 | TRIM72 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LY423413 | Transient overexpression lysate of tripartite motif-containing 72 (TRIM72) | 100 ug |
$665.00
|
|
TP318023 | Recombinant protein of human tripartite motif-containing 72 (TRIM72), 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP750051 | Purified recombinant protein of Human MG53,full length, expressed in E. coli,50ug | 50 ug |
$387.00
|
|
TP750052 | Purified recombinant protein of Human MG53, mutant Cys14Ala, expressed in E. coli,50ug | 50 ug |
$387.00
|
|
TP750131 | Purified recombinant protein of Human MG53,Ala123-Ala477, expressed in E. coli,50ug | 50 ug |
$387.00
|
|
TP750134 | Purified recombinant protein of Human MG53,Met1-Asp270, expressed in E. coli,50ug | 50 ug |
$387.00
|
|
TP750135 | Purified recombinant protein of Human MG53,Asp271-Ala477, expressed in E. coli,50ug | 50 ug |
$387.00
|
|
TP750136 | Purified recombinant protein of Human MG53, Ala58-End, tag free, expressed in E.coli, 50ug | 50 ug |
$373.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.