JRK (NM_001077527) Human Mass Spec Standard

SKU
PH318013
JRK MS Standard C13 and N15-labeled recombinant protein (NP_001070995)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC218013]
Predicted MW 61.5 kDa
Protein Sequence
Protein Sequence
>RC218013 representing NM_001077527
Red=Cloning site Green=Tags(s)

MASKPAAGKSRGEKRKRVVLTLKEKIDICTRLEKGESRKALMQEYNVGMSTLYDIRAHKAQLLRFFASSD
SNKALEQRRTLHTPKLEHLDRVLYEWFLGKRSEGVPVSGPMLIEKAKDFYEQMQLTEPCVFSGGWLWRFK
ARHGIKKLDASSEKQSADHQAAEQFCAFFRSLAAEHGLSAEQVYNADETGLFWRCLPNPTPEGGAVPGPK
QGKDRLTVLMCANATGSHRLKPLAIGKCSGPRAFKGIQHLPVAYKAQGNAWVDKEIFSDWFHHIFVPSVR
EHFRTIGLPEDSKAVLLLDSSRAHPQEAELVSSNVFTIFLPASVASLVQPMEQGIRRDFMRNFINPPVPL
QGPHARYNMNDAIFSVACAWNAVPSHVFRRAWRKLWPSVAFAEGSSSEEELEAECFPVKPHNKSFAHILE
LVKEGSSCPGQLRQRQAASWGVAGREAEGGRPPAATSPAEVVWSSEKTPKADQDGGGDPGEGEEVAWEQA
AVAFDAVLRFAERQPCFSAQEVGQLRALRAVFRSQQQETVGLEDVVVTSPEELAIPKCCLEASTET

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001070995
RefSeq Size 3578
RefSeq ORF 1668
Synonyms jerky; JH8
Locus ID 8629
UniProt ID O75564
Cytogenetics 8q24.3
Summary This gene encodes a conserved protein that is similar to DNA-binding proteins, such as major centromere autoantigen B (CENPB). Inactivation of the related gene in mice resulted in epileptic seizures. Childhood Absence Epilepsy (CAE) has been mapped to the same chromosomal location (8q24.3) as this gene. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]
Protein Families Transcription Factors
Write Your Own Review
You're reviewing:JRK (NM_001077527) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC418476 JRK HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421459 JRK HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418476 Transient overexpression lysate of jerky homolog (mouse) (JRK), transcript variant 1 100 ug
$436.00
LY421459 Transient overexpression lysate of jerky homolog (mouse) (JRK), transcript variant 2 100 ug
$665.00
TP318013 Recombinant protein of human jerky homolog (mouse) (JRK), transcript variant 2, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.