RbAp46 (RBBP7) (NM_002893) Human Mass Spec Standard

SKU
PH317969
RBBP7 MS Standard C13 and N15-labeled recombinant protein (NP_002884)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC217969]
Predicted MW 47.8 kDa
Protein Sequence
Protein Sequence
>RC217969 protein sequence
Red=Cloning site Green=Tags(s)

MASKEMFEDTVEERVINEEYKIWKKNTPFLYDLVMTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTH
TSDEQNHLVVARVHIPNDDAQFDASHCDSDKGEFGGFGSVTGKIECEIKINHEGEVNRARYMPQNPHIIA
TKTPSSDVLVFDYTKHPAKPDPSGECNPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHTVCLWDINAGP
KEGKIVDAKAIFTGHSAVVEDVAWHLLHESLFGSVADDQKLMIWDTRSNTTSKPSHLVDAHTAEVNCLSF
NPYSEFILATGSADKTVALWDLRNLKLKLHTFESHKDEIFQVHWSPHNETILASSGTDRRLNVWDLSKIG
EEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQIWQMAENIYNDEESDVTTSEL
EGQGS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002884
RefSeq Size 2021
RefSeq ORF 1275
Synonyms RbAp46
Locus ID 5931
UniProt ID Q16576
Cytogenetics Xp22.2
Summary This protein is a ubiquitously expressed nuclear protein and belongs to a highly conserved subfamily of WD-repeat proteins. It is found among several proteins that binds directly to retinoblastoma protein, which regulates cell proliferation. The encoded protein is found in many histone deacetylase complexes, including mSin3 co-repressor complex. It is also present in protein complexes involved in chromatin assembly. This protein can interact with BRCA1 tumor-suppressor gene and may have a role in the regulation of cell proliferation and differentiation. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2010]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:RbAp46 (RBBP7) (NM_002893) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC419038 RBBP7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC434255 RBBP7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY419038 Transient overexpression lysate of retinoblastoma binding protein 7 (RBBP7) 100 ug
$665.00
LY434255 Transient overexpression lysate of retinoblastoma binding protein 7 (RBBP7), transcript variant 1 100 ug
$436.00
TP317969 Recombinant protein of human retinoblastoma binding protein 7 (RBBP7), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.