OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RBFOX1 (NM_018723) Human Mass Spec Standard

Be the first to review this product
SKU
PH317960
A2BP1 MS Standard C13 and N15-labeled recombinant protein (NP_061193)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA803488 RBFOX1 mouse monoclonal antibody, clone OTI4F9 (formerly 4F9) 100 ul
$447.00
LY428043 Transient overexpression lysate of ataxin 2-binding protein 1 (A2BP1), transcript variant 6 (as WB positive control) 100 ug
$436.00

Other products for "RBFOX1 or NM_018723"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC217960
Predicted MW 42.6 kDa
Protein Sequence
Protein Sequence
>RC217960 representing NM_018723
Red=Cloning site Green=Tags(s)

MNCEREQLRGNQEAAAAPDTMAQPYASAQFAPPQNGIPAEYTAPHPHPAPEYTGQTTVPEHTLNLYPPAQ
THSEQSPADTSAQTVSGTATQTDDAAPTDGQPQTQPSENTENKSQPKRLHVSNIPFRFRDPDLRQMFGQF
GKILDVEIIFNERGSKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARVMTNKKTVNPYTNGWK
LNPVVGAVYSPEFYAGTVLLCQANQEGSSMYSAPSSLVYTSAMPGFPYPAATAAAAYRGAHLRGRGRTVY
NTFRAAAPPPPIPAYGGVVYQDGFYGADIYGGYAAYRYAQPTPATAAAYSDSYGRVYAADPYHHALAPAP
TYGVGAMNAFAPLTDAKTRSHADDVGLVLSSLQASIYRGGYNRFAPY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_061193
RefSeq Size 2279
RefSeq ORF 1191
Synonyms 2BP1; A2BP1; FOX-1; FOX1; HRNBP1
Locus ID 54715
UniProt ID Q9NWB1
Cytogenetics 16p13.3
Summary The Fox-1 family of RNA-binding proteins is evolutionarily conserved, and regulates tissue-specific alternative splicing in metazoa. Fox-1 recognizes a (U)GCAUG stretch in regulated exons or in flanking introns. The protein binds to the C-terminus of ataxin-2 and may contribute to the restricted pathology of spinocerebellar ataxia type 2 (SCA2). Ataxin-2 is the product of the SCA2 gene which causes familial neurodegenerative diseases. Fox-1 and ataxin-2 are both localized in the trans-Golgi network. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Nov 2011
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RBFOX1" proteins (14)
SKU Description Size Price
LC402712 Lyophilized RBFOX1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC407829 Lyophilized RBFOX1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC407830 Lyophilized RBFOX1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC407831 Lyophilized RBFOX1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428042 Lyophilized RBFOX1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428043 Lyophilized RBFOX1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402712 Transient overexpression lysate of ataxin 2-binding protein 1 (A2BP1), transcript variant 4 (as WB positive control) 100 ug
$436.00
LY407829 Transient overexpression lysate of ataxin 2-binding protein 1 (A2BP1), transcript variant 1 (as WB positive control) 100 ug
$665.00
LY407830 Transient overexpression lysate of ataxin 2-binding protein 1 (A2BP1), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY407831 Transient overexpression lysate of ataxin 2-binding protein 1 (A2BP1), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY428042 Transient overexpression lysate of ataxin 2-binding protein 1 (A2BP1), transcript variant 5 (as WB positive control) 100 ug
$436.00
LY428043 Transient overexpression lysate of ataxin 2-binding protein 1 (A2BP1), transcript variant 6 (as WB positive control) 100 ug
$436.00
TP317960 Recombinant protein of human ataxin 2-binding protein 1 (A2BP1), transcript variant 4, 20 µg 20 ug
$867.00
TP761105 Purified recombinant protein of Human RNA binding protein, fox-1 homolog (C. elegans) 1 (RBFOX1), transcript variant 6, full length, with N-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$270.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products