RBFOX1 (NM_018723) Human Mass Spec Standard

SKU
PH317960
A2BP1 MS Standard C13 and N15-labeled recombinant protein (NP_061193)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC217960]
Predicted MW 42.6 kDa
Protein Sequence
Protein Sequence
>RC217960 representing NM_018723
Red=Cloning site Green=Tags(s)

MNCEREQLRGNQEAAAAPDTMAQPYASAQFAPPQNGIPAEYTAPHPHPAPEYTGQTTVPEHTLNLYPPAQ
THSEQSPADTSAQTVSGTATQTDDAAPTDGQPQTQPSENTENKSQPKRLHVSNIPFRFRDPDLRQMFGQF
GKILDVEIIFNERGSKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARVMTNKKTVNPYTNGWK
LNPVVGAVYSPEFYAGTVLLCQANQEGSSMYSAPSSLVYTSAMPGFPYPAATAAAAYRGAHLRGRGRTVY
NTFRAAAPPPPIPAYGGVVYQDGFYGADIYGGYAAYRYAQPTPATAAAYSDSYGRVYAADPYHHALAPAP
TYGVGAMNAFAPLTDAKTRSHADDVGLVLSSLQASIYRGGYNRFAPY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_061193
RefSeq Size 2279
RefSeq ORF 1191
Synonyms 2BP1; A2BP1; FOX-1; FOX1; HRNBP1
Locus ID 54715
UniProt ID Q9NWB1
Cytogenetics 16p13.3
Summary The Fox-1 family of RNA-binding proteins is evolutionarily conserved, and regulates tissue-specific alternative splicing in metazoa. Fox-1 recognizes a (U)GCAUG stretch in regulated exons or in flanking introns. The protein binds to the C-terminus of ataxin-2 and may contribute to the restricted pathology of spinocerebellar ataxia type 2 (SCA2). Ataxin-2 is the product of the SCA2 gene which causes familial neurodegenerative diseases. Fox-1 and ataxin-2 are both localized in the trans-Golgi network. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2011]
Write Your Own Review
You're reviewing:RBFOX1 (NM_018723) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC402712 RBFOX1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC407829 RBFOX1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC407830 RBFOX1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC407831 RBFOX1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428042 RBFOX1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428043 RBFOX1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402712 Transient overexpression lysate of ataxin 2-binding protein 1 (A2BP1), transcript variant 4 100 ug
$436.00
LY407829 Transient overexpression lysate of ataxin 2-binding protein 1 (A2BP1), transcript variant 1 100 ug
$665.00
LY407830 Transient overexpression lysate of ataxin 2-binding protein 1 (A2BP1), transcript variant 2 100 ug
$436.00
LY407831 Transient overexpression lysate of ataxin 2-binding protein 1 (A2BP1), transcript variant 3 100 ug
$436.00
LY428042 Transient overexpression lysate of ataxin 2-binding protein 1 (A2BP1), transcript variant 5 100 ug
$436.00
LY428043 Transient overexpression lysate of ataxin 2-binding protein 1 (A2BP1), transcript variant 6 100 ug
$436.00
TP317960 Recombinant protein of human ataxin 2-binding protein 1 (A2BP1), transcript variant 4, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP761105 Purified recombinant protein of Human RNA binding protein, fox-1 homolog (C. elegans) 1 (RBFOX1), transcript variant 6, full length, with N-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.