PTP4A3 (NM_007079) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC217944] |
Predicted MW | 16.6 kDa |
Protein Sequence |
Protein Sequence
>RC217944 representing NM_007079
Red=Cloning site Green=Tags(s) MARMNRPAPVEVSYKHMRFLITHNPTNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEKDGITVVDWPF DDGAPPPGKVVEDWLSLVKAKFCEAPGSCVAVHCVAGLGRKRRGAINSKQLTYLEKYRPKQRLRFKDPHT HKTRCCVM myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_009010 |
RefSeq Size | 1321 |
RefSeq ORF | 444 |
Synonyms | PRL-3; PRL-R; PRL3 |
Locus ID | 11156 |
UniProt ID | O75365 |
Cytogenetics | 8q24.3 |
Summary | This gene encodes a member of the protein-tyrosine phosphatase family. Protein tyrosine phosphatases are cell signaling molecules that play regulatory roles in a variety of cellular processes. Studies of this class of protein tyrosine phosphatase in mice demonstrates that they are prenylated in vivo, suggesting their association with cell plasma membrane. The encoded protein may enhance cell proliferation, and overexpression of this gene has been implicated in tumor metastasis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013] |
Protein Families | Druggable Genome, Phosphatase |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH312193 | PTP4A3 MS Standard C13 and N15-labeled recombinant protein (NP_116000) | 10 ug |
$3,255.00
|
|
LC410006 | PTP4A3 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC416216 | PTP4A3 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY410006 | Transient overexpression lysate of protein tyrosine phosphatase type IVA, member 3 (PTP4A3), transcript variant 1 | 100 ug |
$436.00
|
|
LY416216 | Transient overexpression lysate of protein tyrosine phosphatase type IVA, member 3 (PTP4A3), transcript variant 2 | 100 ug |
$436.00
|
|
TP312193 | Recombinant protein of human protein tyrosine phosphatase type IVA, member 3 (PTP4A3), transcript variant 1, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP317944 | Recombinant protein of human protein tyrosine phosphatase type IVA, member 3 (PTP4A3), transcript variant 2, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP761759 | Purified recombinant protein of Human protein tyrosine phosphatase type IVA, member 3 (PTP4A3), transcript variant 2, full length, with N-terminal His tag, expressed in E. coli, 50ug | 50 ug |
$261.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.