PTP4A3 (NM_007079) Human Mass Spec Standard

SKU
PH317944
PTP4A3 MS Standard C13 and N15-labeled recombinant protein (NP_009010)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC217944]
Predicted MW 16.6 kDa
Protein Sequence
Protein Sequence
>RC217944 representing NM_007079
Red=Cloning site Green=Tags(s)

MARMNRPAPVEVSYKHMRFLITHNPTNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEKDGITVVDWPF
DDGAPPPGKVVEDWLSLVKAKFCEAPGSCVAVHCVAGLGRKRRGAINSKQLTYLEKYRPKQRLRFKDPHT
HKTRCCVM

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_009010
RefSeq Size 1321
RefSeq ORF 444
Synonyms PRL-3; PRL-R; PRL3
Locus ID 11156
UniProt ID O75365
Cytogenetics 8q24.3
Summary This gene encodes a member of the protein-tyrosine phosphatase family. Protein tyrosine phosphatases are cell signaling molecules that play regulatory roles in a variety of cellular processes. Studies of this class of protein tyrosine phosphatase in mice demonstrates that they are prenylated in vivo, suggesting their association with cell plasma membrane. The encoded protein may enhance cell proliferation, and overexpression of this gene has been implicated in tumor metastasis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]
Protein Families Druggable Genome, Phosphatase
Write Your Own Review
You're reviewing:PTP4A3 (NM_007079) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH312193 PTP4A3 MS Standard C13 and N15-labeled recombinant protein (NP_116000) 10 ug
$3,255.00
LC410006 PTP4A3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC416216 PTP4A3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY410006 Transient overexpression lysate of protein tyrosine phosphatase type IVA, member 3 (PTP4A3), transcript variant 1 100 ug
$436.00
LY416216 Transient overexpression lysate of protein tyrosine phosphatase type IVA, member 3 (PTP4A3), transcript variant 2 100 ug
$436.00
TP312193 Recombinant protein of human protein tyrosine phosphatase type IVA, member 3 (PTP4A3), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP317944 Recombinant protein of human protein tyrosine phosphatase type IVA, member 3 (PTP4A3), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP761759 Purified recombinant protein of Human protein tyrosine phosphatase type IVA, member 3 (PTP4A3), transcript variant 2, full length, with N-terminal His tag, expressed in E. coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.