OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DEF6 (NM_022047) Human Mass Spec Standard

Be the first to review this product
SKU
PH317877
DEF6 MS Standard C13 and N15-labeled recombinant protein (NP_071330)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA505321 DEF6 mouse monoclonal antibody, clone OTI1E3 (formerly 1E3) 100 ul
$447.00
LY411815 Transient overexpression lysate of differentially expressed in FDCP 6 homolog (mouse) (DEF6) (as WB positive control) 100 ug
$665.00

Other products for "DEF6 or NM_022047"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC217877
Predicted MW 73.7 kDa
Protein Sequence
Protein Sequence
>RC217877 representing NM_022047
Red=Cloning site Green=Tags(s)

MALRKELLKSIWYAFTALDVEKSGKVSKSQLKVLSHNLYTVLHIPHDPVALEEHFRDDDDGPVSSQGYMP
YLNKYILDKVEEGAFVKEHFDELCWTLTAKKNYRADSNGNSMLSNQDAFRLWCLFNFLSEDKYPLIMVPD
EVEYLLKKVLSSMSLEVSLGELEELLAQEAQVAQTTGGLSVWQFLELFNSGRCLRGVGRDTLSMAIHEVY
QELIQDVLKQGYLWKRGHLRRNWAERWFQLQPSCLCYFGSEECKEKRGIIPLDAHCCVEVLPDRDGKRCM
FCVKTATRTYEMSASDTRQRQEWTAAIQMAIRLQAEGKTSLHKDLKQKRREQREQRERRRAAKEEELLRL
QQLQEEKERKLQELELLQEAQRQAERLLQEEEERRRSQHRELQQALEGQLREAEQARASMQAEMELKEEE
AARQRQRIKELEEMQQRLQEALQLEVKARRDEESVRIAQTRLLEEEEEKLKQLMQLKEEQERYIERAQQE
KEELQQEMAQQSRSLQQAQQQLEEVRQNRQRADEDVEAAQRKLRQASTNVKHWNVQMNRLMHPIEPGDKR
PVTSSSFSGFQPPLLAHRDSSLKRLTRWGSQGNRTPSPNSNEQQKSLNGGDEAPAPASTPQEDKLDPAPE
N

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_071330
RefSeq Size 2320
RefSeq ORF 1893
Synonyms IBP; SLAT; SWAP70L
Locus ID 50619
UniProt ID Q9H4E7
Cytogenetics 6p21.31
Summary DEF6, or IBP, is a guanine nucleotide exchange factor (GEF) for RAC (MIM 602048) and CDC42 (MIM 116952) that is highly expressed in B and T cells (Gupta et al., 2003 PubMed 12923183).supplied by OMIM, Mar 2008
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "DEF6" proteins (4)
SKU Description Size Price
LC411815 Lyophilized DEF6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411815 Transient overexpression lysate of differentially expressed in FDCP 6 homolog (mouse) (DEF6) (as WB positive control) 100 ug
$665.00
TP317877 Recombinant protein of human differentially expressed in FDCP 6 homolog (mouse) (DEF6), 20 µg 20 ug
$737.00
TP761224 Purified recombinant protein of Human differentially expressed in FDCP 6 homolog (mouse) (DEF6), full length, with N-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$270.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products